Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 128147..128883 Replicon plasmid pHSKP8-2
Accession NZ_CP100089
Organism Klebsiella pneumoniae strain HSKP8

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag NIL17_RS27435 Protein ID WP_003026803.1
Coordinates 128401..128883 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NIL17_RS27430 Protein ID WP_003026799.1
Coordinates 128147..128413 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL17_RS27385 (NIL17_27370) 124209..124571 - 363 WP_215402459.1 arsenite efflux transporter metallochaperone ArsD -
NIL17_RS27390 (NIL17_27375) 124621..124971 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NIL17_RS27395 (NIL17_27380) 125329..125598 + 270 WP_004152102.1 hypothetical protein -
NIL17_RS27400 (NIL17_27385) 125586..126161 + 576 WP_004152103.1 hypothetical protein -
NIL17_RS27405 (NIL17_27390) 126192..126686 + 495 WP_004152104.1 DNA-binding protein -
NIL17_RS27410 (NIL17_27395) 126730..127098 + 369 WP_004152105.1 hypothetical protein -
NIL17_RS27415 (NIL17_27400) 127132..127335 + 204 WP_004152106.1 HHA domain-containing protein -
NIL17_RS27420 (NIL17_27405) 127384..127641 + 258 WP_004152107.1 hypothetical protein -
NIL17_RS27425 (NIL17_27410) 127717..127971 + 255 WP_004152108.1 hypothetical protein -
NIL17_RS27430 (NIL17_27415) 128147..128413 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NIL17_RS27435 (NIL17_27420) 128401..128883 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
NIL17_RS27440 (NIL17_27425) 129095..130441 + 1347 WP_138920866.1 ISNCY family transposase -
NIL17_RS27445 130602..130733 + 132 WP_004218042.1 hypothetical protein -
NIL17_RS27450 (NIL17_27430) 130942..132107 - 1166 Protein_155 IS3 family transposase -
NIL17_RS27455 (NIL17_27435) 132284..133246 - 963 WP_004152113.1 zinc metalloprotease HtpX -
NIL17_RS27460 (NIL17_27440) 133233..133721 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) - 1..201702 201702


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T250109 WP_003026803.1 NZ_CP100089:128401-128883 [Klebsiella pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT250109 WP_003026799.1 NZ_CP100089:128147-128413 [Klebsiella pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References