Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 53646..54289 Replicon plasmid pHSKP8-2
Accession NZ_CP100089
Organism Klebsiella pneumoniae strain HSKP8

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag NIL17_RS27040 Protein ID WP_014386165.1
Coordinates 53873..54289 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag NIL17_RS27035 Protein ID WP_032408893.1
Coordinates 53646..53876 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL17_RS27010 (NIL17_26995) 48719..49702 - 984 WP_001471744.1 NAD(P)H-quinone oxidoreductase -
NIL17_RS27015 (NIL17_27000) 49721..50869 - 1149 WP_014386168.1 ABC transporter ATP-binding protein -
NIL17_RS27020 (NIL17_27005) 51040..52197 - 1158 WP_032408895.1 acetylornithine deacetylase -
NIL17_RS27025 (NIL17_27010) 52213..52887 - 675 WP_014386166.1 DUF1028 domain-containing protein -
NIL17_RS27030 (NIL17_27015) 52892..53326 - 435 WP_000103648.1 RidA family protein -
NIL17_RS27035 (NIL17_27020) 53646..53876 + 231 WP_032408893.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIL17_RS27040 (NIL17_27025) 53873..54289 + 417 WP_014386165.1 PIN domain-containing protein Toxin
NIL17_RS27045 (NIL17_27030) 54612..55578 + 967 Protein_74 IS5-like element IS903B family transposase -
NIL17_RS27050 (NIL17_27035) 55758..56132 - 375 WP_032408891.1 hypothetical protein -
NIL17_RS27055 (NIL17_27040) 56188..56514 - 327 WP_001568059.1 hypothetical protein -
NIL17_RS27060 (NIL17_27045) 56511..57239 - 729 WP_014386162.1 plasmid SOS inhibition protein A -
NIL17_RS27065 (NIL17_27050) 57236..57667 - 432 WP_014386161.1 conjugation system SOS inhibitor PsiB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) - 1..201702 201702


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T250108 WP_014386165.1 NZ_CP100089:53873-54289 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT250108 WP_032408893.1 NZ_CP100089:53646-53876 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References