Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 29750..30495 Replicon plasmid pHSKP8-2
Accession NZ_CP100089
Organism Klebsiella pneumoniae strain HSKP8

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag NIL17_RS26910 Protein ID WP_032408901.1
Coordinates 30004..30495 (+) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag NIL17_RS26905 Protein ID WP_014386183.1
Coordinates 29750..30016 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL17_RS26855 (NIL17_26840) 25302..25715 - 414 WP_013023817.1 helix-turn-helix domain-containing protein -
NIL17_RS26860 (NIL17_26845) 25716..25994 - 279 WP_004152721.1 helix-turn-helix transcriptional regulator -
NIL17_RS26865 (NIL17_26850) 25984..26304 - 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
NIL17_RS26870 (NIL17_26855) 26385..26609 - 225 WP_014386189.1 hypothetical protein -
NIL17_RS26875 (NIL17_26860) 26620..26832 - 213 WP_014386188.1 hypothetical protein -
NIL17_RS26880 (NIL17_26865) 26894..27220 - 327 WP_014386187.1 hypothetical protein -
NIL17_RS26885 (NIL17_26870) 27857..28207 - 351 WP_014386186.1 hypothetical protein -
NIL17_RS26890 (NIL17_26875) 28204..28476 - 273 WP_032408902.1 hypothetical protein -
NIL17_RS26895 (NIL17_26880) 28666..29151 + 486 WP_014386185.1 hypothetical protein -
NIL17_RS26900 (NIL17_26885) 29395..29553 - 159 WP_014386184.1 type I toxin-antitoxin system Hok family toxin -
NIL17_RS26905 (NIL17_26890) 29750..30016 + 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
NIL17_RS26910 (NIL17_26895) 30004..30495 + 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
NIL17_RS26915 (NIL17_26900) 30936..31187 - 252 WP_032408900.1 aldo/keto reductase -
NIL17_RS26920 (NIL17_26905) 31384..32976 - 1593 Protein_49 IS66 family transposase -
NIL17_RS26925 (NIL17_26910) 33007..33357 - 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
NIL17_RS26930 (NIL17_26915) 33354..33794 - 441 WP_014386179.1 transposase -
NIL17_RS26935 (NIL17_26920) 34056..34811 - 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) - 1..201702 201702


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T250107 WP_032408901.1 NZ_CP100089:30004-30495 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT250107 WP_014386183.1 NZ_CP100089:29750-30016 [Klebsiella pneumoniae]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References