Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 81341..81866 Replicon plasmid pHSKP8-1
Accession NZ_CP100088
Organism Klebsiella pneumoniae strain HSKP8

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NIL17_RS26580 Protein ID WP_013023785.1
Coordinates 81341..81646 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NIL17_RS26585 Protein ID WP_001568025.1
Coordinates 81648..81866 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL17_RS26550 (NIL17_26535) 76948..77574 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
NIL17_RS26555 (NIL17_26540) 77571..77873 + 303 WP_004197636.1 hypothetical protein -
NIL17_RS26560 (NIL17_26545) 78417..79211 - 795 WP_004197635.1 site-specific integrase -
NIL17_RS26565 (NIL17_26550) 79409..80425 - 1017 WP_017899884.1 hypothetical protein -
NIL17_RS26570 (NIL17_26555) 80436..80750 - 315 WP_053389906.1 hypothetical protein -
NIL17_RS26575 (NIL17_26560) 80777..81172 - 396 WP_017899885.1 hypothetical protein -
NIL17_RS26580 (NIL17_26565) 81341..81646 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NIL17_RS26585 (NIL17_26570) 81648..81866 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIL17_RS26590 (NIL17_26575) 82036..82497 - 462 WP_160880186.1 hypothetical protein -
NIL17_RS26595 (NIL17_26580) 82454..82684 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
NIL17_RS26600 (NIL17_26585) 82681..83097 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
NIL17_RS26605 (NIL17_26590) 83171..84733 + 1563 WP_004206609.1 AAA family ATPase -
NIL17_RS26610 (NIL17_26595) 84718..85740 + 1023 WP_000361404.1 helicase UvrD -
NIL17_RS26615 (NIL17_26600) 85996..86693 + 698 WP_223174630.1 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 - 1..94350 94350


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T250105 WP_013023785.1 NZ_CP100088:c81646-81341 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT250105 WP_001568025.1 NZ_CP100088:c81866-81648 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References