Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1278515..1279356 | Replicon | chromosome |
Accession | NZ_CP100087 | ||
Organism | Klebsiella pneumoniae strain HSKP8 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1M0WJM1 |
Locus tag | NIL17_RS06210 | Protein ID | WP_000854822.1 |
Coordinates | 1278973..1279356 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M0CWL2 |
Locus tag | NIL17_RS06205 | Protein ID | WP_053271974.1 |
Coordinates | 1278515..1278883 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL17_RS06185 (1276260) | 1276260..1277078 | + | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
NIL17_RS06190 (1277169) | 1277169..1277654 | + | 486 | WP_000214317.1 | antirestriction protein | - |
NIL17_RS06195 (1277669) | 1277669..1278145 | + | 477 | WP_001186747.1 | RadC family protein | - |
NIL17_RS06200 (1278214) | 1278214..1278435 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
NIL17_RS06205 (1278515) | 1278515..1278883 | + | 369 | WP_053271974.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NIL17_RS06210 (1278973) | 1278973..1279356 | + | 384 | WP_000854822.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
NIL17_RS06215 (1279347) | 1279347..1279835 | + | 489 | WP_001177592.1 | DUF5983 family protein | - |
NIL17_RS06220 (1279802) | 1279802..1280044 | + | 243 | WP_166635458.1 | DUF957 domain-containing protein | - |
NIL17_RS06225 (1280141) | 1280141..1280986 | + | 846 | WP_001280435.1 | DUF4942 domain-containing protein | - |
NIL17_RS06235 (1281285) | 1281285..1281791 | + | 507 | WP_002917636.1 | G/U mismatch-specific DNA glycosylase | - |
NIL17_RS06240 (1281891) | 1281891..1283732 | - | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14295.32 Da Isoelectric Point: 8.2830
>T250095 WP_000854822.1 NZ_CP100087:1278973-1279356 [Klebsiella pneumoniae]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
Download Length: 384 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13679.41 Da Isoelectric Point: 6.4758
>AT250095 WP_053271974.1 NZ_CP100087:1278515-1278883 [Klebsiella pneumoniae]
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0WJM1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0CWL2 |