Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 6953..7596 Replicon plasmid pHSKP86-2
Accession NZ_CP100086
Organism Klebsiella pneumoniae strain HSKP86

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NIL18_RS27535 Protein ID WP_001044770.1
Coordinates 7180..7596 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NIL18_RS27530 Protein ID WP_001261282.1
Coordinates 6953..7183 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL18_RS27490 (NIL18_27470) 2166..2468 + 303 WP_004197636.1 hypothetical protein -
NIL18_RS27495 (NIL18_27475) 2916..3710 - 795 WP_004197635.1 site-specific integrase -
NIL18_RS27500 (NIL18_27480) 3908..4924 - 1017 WP_017899884.1 hypothetical protein -
NIL18_RS27505 (NIL18_27485) 4935..5249 - 315 WP_053389906.1 hypothetical protein -
NIL18_RS27510 (NIL18_27490) 5276..5671 - 396 WP_017899885.1 hypothetical protein -
NIL18_RS27515 (NIL18_27495) 5840..6145 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
NIL18_RS27520 (NIL18_27500) 6147..6365 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
NIL18_RS27525 (NIL18_27505) 6535..6996 - 462 WP_160880186.1 hypothetical protein -
NIL18_RS27530 (NIL18_27510) 6953..7183 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIL18_RS27535 (NIL18_27515) 7180..7596 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NIL18_RS27540 (NIL18_27520) 7670..9232 + 1563 WP_004206609.1 AAA family ATPase -
NIL18_RS27545 (NIL18_27525) 9217..10239 + 1023 WP_000361404.1 helicase UvrD -
NIL18_RS27550 (NIL18_27530) 10495..11192 + 698 WP_223174630.1 IS1 family transposase -
NIL18_RS27555 (NIL18_27535) 11221..11493 + 273 Protein_15 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 - 1..94061 94061


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T250090 WP_001044770.1 NZ_CP100086:7180-7596 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT250090 WP_001261282.1 NZ_CP100086:6953-7183 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References