Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 194774..195417 Replicon plasmid pHSKP86-1
Accession NZ_CP100085
Organism Klebsiella pneumoniae strain HSKP86

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag NIL18_RS27365 Protein ID WP_014386165.1
Coordinates 195001..195417 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag NIL18_RS27360 Protein ID WP_032408893.1
Coordinates 194774..195004 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL18_RS27335 (NIL18_27315) 189847..190830 - 984 WP_001471744.1 NAD(P)H-quinone oxidoreductase -
NIL18_RS27340 (NIL18_27320) 190849..191997 - 1149 WP_014386168.1 ABC transporter ATP-binding protein -
NIL18_RS27345 (NIL18_27325) 192168..193325 - 1158 WP_032408895.1 acetylornithine deacetylase -
NIL18_RS27350 (NIL18_27330) 193341..194015 - 675 WP_014386166.1 DUF1028 domain-containing protein -
NIL18_RS27355 (NIL18_27335) 194020..194454 - 435 WP_000103648.1 RidA family protein -
NIL18_RS27360 (NIL18_27340) 194774..195004 + 231 WP_032408893.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIL18_RS27365 (NIL18_27345) 195001..195417 + 417 WP_014386165.1 PIN domain-containing protein Toxin
NIL18_RS27370 (NIL18_27350) 195740..196708 + 969 WP_074422984.1 IS5-like element IS903B family transposase -
NIL18_RS27375 (NIL18_27355) 196888..197262 - 375 WP_032408891.1 hypothetical protein -
NIL18_RS27380 (NIL18_27360) 197318..197644 - 327 WP_004152639.1 hypothetical protein -
NIL18_RS27385 (NIL18_27365) 197641..198369 - 729 WP_014386162.1 plasmid SOS inhibition protein A -
NIL18_RS27390 (NIL18_27370) 198366..198797 - 432 WP_014386161.1 conjugation system SOS inhibitor PsiB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) - 1..215633 215633
- flank IS/Tn - - 195740..196708 968


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-130)

Antitoxin

SpoVT-AbrB domain

(7-55)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15127.44 Da        Isoelectric Point: 7.8841

>T250088 WP_014386165.1 NZ_CP100085:195001-195417 [Klebsiella pneumoniae]
MTKTYMLDTNICSYIMREQPEAVLKRLEQAVLRRHRIVVSAITYAEMRFGAIGKRASPRHVQLVDAFCARLDAILAWDRA
AVDATTEVKATLAAAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVAGLTFEDWVQ

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8854.89 Da        Isoelectric Point: 4.5112

>AT250088 WP_032408893.1 NZ_CP100085:194774-195004 [Klebsiella pneumoniae]
MRTVSVFRNGNNRAIRLPRDLDFDGVNELEIIREGDTLILRPVKPSWSSFRQEEKADADFMAERENVVSDEGRFEL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References