Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 170878..171623 Replicon plasmid pHSKP86-1
Accession NZ_CP100085
Organism Klebsiella pneumoniae strain HSKP86

Toxin (Protein)


Gene name tacT Uniprot ID A0A331KSM6
Locus tag NIL18_RS27235 Protein ID WP_032408901.1
Coordinates 171132..171623 (+) Length 164 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID -
Locus tag NIL18_RS27230 Protein ID WP_014386183.1
Coordinates 170878..171144 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL18_RS27180 (NIL18_27160) 166430..166843 - 414 WP_013023817.1 helix-turn-helix domain-containing protein -
NIL18_RS27185 (NIL18_27165) 166844..167122 - 279 WP_004152721.1 helix-turn-helix transcriptional regulator -
NIL18_RS27190 (NIL18_27170) 167112..167432 - 321 WP_014386190.1 type II toxin-antitoxin system RelE/ParE family toxin -
NIL18_RS27195 (NIL18_27175) 167513..167737 - 225 WP_014386189.1 hypothetical protein -
NIL18_RS27200 (NIL18_27180) 167748..167960 - 213 WP_014386188.1 hypothetical protein -
NIL18_RS27205 (NIL18_27185) 168022..168348 - 327 WP_014386187.1 hypothetical protein -
NIL18_RS27210 (NIL18_27190) 168985..169335 - 351 WP_014386186.1 hypothetical protein -
NIL18_RS27215 (NIL18_27195) 169332..169604 - 273 WP_032408902.1 hypothetical protein -
NIL18_RS27220 (NIL18_27200) 169794..170279 + 486 WP_014386185.1 hypothetical protein -
NIL18_RS27225 (NIL18_27205) 170523..170681 - 159 WP_014386184.1 type I toxin-antitoxin system Hok family toxin -
NIL18_RS27230 (NIL18_27210) 170878..171144 + 267 WP_014386183.1 DUF1778 domain-containing protein Antitoxin
NIL18_RS27235 (NIL18_27215) 171132..171623 + 492 WP_032408901.1 GNAT family N-acetyltransferase Toxin
NIL18_RS27240 (NIL18_27220) 172064..172315 - 252 WP_032408900.1 aldo/keto reductase -
NIL18_RS27245 (NIL18_27225) 172512..174104 - 1593 Protein_190 IS66 family transposase -
NIL18_RS27250 (NIL18_27230) 174135..174485 - 351 WP_014386180.1 IS66 family insertion sequence element accessory protein TnpB -
NIL18_RS27255 (NIL18_27235) 174482..174922 - 441 WP_014386179.1 transposase -
NIL18_RS27260 (NIL18_27240) 175184..175939 - 756 WP_032408898.1 DeoR/GlpR family DNA-binding transcription regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / blaOXA-1 / aac(6')-Ib-cr / blaCTX-M-15 / blaTEM-1B / mph(A) - 1..215633 215633


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(89-149)

Antitoxin

Vibrio phage ICP1, Orf50

(2-87)


Sequences

Toxin        


Download         Length: 164 a.a.        Molecular weight: 17667.46 Da        Isoelectric Point: 8.8757

>T250087 WP_032408901.1 NZ_CP100085:171132-171623 [Klebsiella pneumoniae]
VGKVTAPVPLGTSHILAEFHCGEPVLDEWIKHRGLKNQSLGAARTFVVCRGNASQVLAYYSLATGSVTHAIAPGSLRRNM
PDPVPVIILARLAVDTSYHGQGLGADLLHDAVLRCCRVAENIGVRAVMVHALSDSARQFYIHHGFIPSQTQDRTLFLRLP
LIT

Download         Length: 492 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10090.66 Da        Isoelectric Point: 5.1169

>AT250087 WP_014386183.1 NZ_CP100085:170878-171144 [Klebsiella pneumoniae]
MKSDVQLNIRAKEAQRALIDTAAEILHKSRTDFILEMACQAAENVILDRRMFNLNDEQYAEFIDMLDAPVTANPAMEKLL
ARKPQWAK

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A331KSM6

Antitoxin

Source ID Structure

References