Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4147825..4148444 | Replicon | chromosome |
| Accession | NZ_CP100084 | ||
| Organism | Klebsiella pneumoniae strain HSKP86 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NIL18_RS20245 | Protein ID | WP_002892050.1 |
| Coordinates | 4148226..4148444 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NIL18_RS20240 | Protein ID | WP_002892066.1 |
| Coordinates | 4147825..4148199 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL18_RS20230 (4142977) | 4142977..4144170 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NIL18_RS20235 (4144193) | 4144193..4147339 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NIL18_RS20240 (4147825) | 4147825..4148199 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NIL18_RS20245 (4148226) | 4148226..4148444 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NIL18_RS20250 (4148603) | 4148603..4149169 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NIL18_RS20255 (4149141) | 4149141..4149281 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NIL18_RS20260 (4149302) | 4149302..4149772 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| NIL18_RS20265 (4149747) | 4149747..4151198 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| NIL18_RS20270 (4151299) | 4151299..4151997 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| NIL18_RS20275 (4151994) | 4151994..4152134 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NIL18_RS20280 (4152134) | 4152134..4152397 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T250081 WP_002892050.1 NZ_CP100084:4148226-4148444 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT250081 WP_002892066.1 NZ_CP100084:4147825-4148199 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |