Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4147825..4148444 Replicon chromosome
Accession NZ_CP100084
Organism Klebsiella pneumoniae strain HSKP86

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NIL18_RS20245 Protein ID WP_002892050.1
Coordinates 4148226..4148444 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NIL18_RS20240 Protein ID WP_002892066.1
Coordinates 4147825..4148199 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL18_RS20230 (4142977) 4142977..4144170 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NIL18_RS20235 (4144193) 4144193..4147339 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NIL18_RS20240 (4147825) 4147825..4148199 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NIL18_RS20245 (4148226) 4148226..4148444 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NIL18_RS20250 (4148603) 4148603..4149169 + 567 WP_002892030.1 maltose O-acetyltransferase -
NIL18_RS20255 (4149141) 4149141..4149281 - 141 WP_004147370.1 hypothetical protein -
NIL18_RS20260 (4149302) 4149302..4149772 + 471 WP_002892026.1 YlaC family protein -
NIL18_RS20265 (4149747) 4149747..4151198 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NIL18_RS20270 (4151299) 4151299..4151997 + 699 WP_002892021.1 GNAT family protein -
NIL18_RS20275 (4151994) 4151994..4152134 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NIL18_RS20280 (4152134) 4152134..4152397 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T250081 WP_002892050.1 NZ_CP100084:4148226-4148444 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT250081 WP_002892066.1 NZ_CP100084:4147825-4148199 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References