Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 846597..847254 | Replicon | chromosome |
Accession | NZ_CP100084 | ||
Organism | Klebsiella pneumoniae strain HSKP86 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | NIL18_RS04225 | Protein ID | WP_002916310.1 |
Coordinates | 846844..847254 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NIL18_RS04220 | Protein ID | WP_002916312.1 |
Coordinates | 846597..846863 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL18_RS04195 (841753) | 841753..843186 | - | 1434 | WP_004185559.1 | 6-phospho-beta-glucosidase BglA | - |
NIL18_RS04200 (843305) | 843305..844033 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
NIL18_RS04205 (844083) | 844083..844394 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
NIL18_RS04210 (844558) | 844558..845217 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
NIL18_RS04215 (845368) | 845368..846351 | - | 984 | WP_020324927.1 | tRNA-modifying protein YgfZ | - |
NIL18_RS04220 (846597) | 846597..846863 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NIL18_RS04225 (846844) | 846844..847254 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
NIL18_RS04230 (847261) | 847261..847782 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
NIL18_RS04235 (847883) | 847883..848779 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
NIL18_RS04240 (848802) | 848802..849515 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NIL18_RS04245 (849521) | 849521..851254 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T250074 WP_002916310.1 NZ_CP100084:846844-847254 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |