Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 697794..698635 | Replicon | chromosome |
Accession | NZ_CP100084 | ||
Organism | Klebsiella pneumoniae strain HSKP86 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A1M0WJM1 |
Locus tag | NIL18_RS03465 | Protein ID | WP_000854822.1 |
Coordinates | 698252..698635 (+) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1M0CWL2 |
Locus tag | NIL18_RS03460 | Protein ID | WP_053271974.1 |
Coordinates | 697794..698162 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL18_RS03435 (693848) | 693848..695212 | + | 1365 | Protein_675 | autotransporter adhesin family protein | - |
NIL18_RS03440 (695539) | 695539..696357 | + | 819 | WP_001234702.1 | DUF932 domain-containing protein | - |
NIL18_RS03445 (696448) | 696448..696933 | + | 486 | WP_000214317.1 | antirestriction protein | - |
NIL18_RS03450 (696948) | 696948..697424 | + | 477 | WP_001186747.1 | RadC family protein | - |
NIL18_RS03455 (697493) | 697493..697714 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
NIL18_RS03460 (697794) | 697794..698162 | + | 369 | WP_053271974.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NIL18_RS03465 (698252) | 698252..698635 | + | 384 | WP_000854822.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
NIL18_RS03470 (698626) | 698626..699114 | + | 489 | WP_001177592.1 | DUF5983 family protein | - |
NIL18_RS03475 (699081) | 699081..699323 | + | 243 | WP_166635458.1 | DUF957 domain-containing protein | - |
NIL18_RS03480 (699420) | 699420..700265 | + | 846 | WP_001280435.1 | DUF4942 domain-containing protein | - |
NIL18_RS03490 (700564) | 700564..701070 | + | 507 | WP_002917636.1 | G/U mismatch-specific DNA glycosylase | - |
NIL18_RS03495 (701170) | 701170..703011 | - | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14295.32 Da Isoelectric Point: 8.2830
>T250073 WP_000854822.1 NZ_CP100084:698252-698635 [Klebsiella pneumoniae]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHQESKRCN
Download Length: 384 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13679.41 Da Isoelectric Point: 6.4758
>AT250073 WP_053271974.1 NZ_CP100084:697794-698162 [Klebsiella pneumoniae]
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLTDRAGIRGRFSDADANHLDQAFPLLMKQLELMLTSS
ELNPHRQNTVTLYVKGLTCHADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0WJM1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1M0CWL2 |