Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 43176..43819 Replicon plasmid pRJKP36-3
Accession NZ_CP100079
Organism Klebsiella pneumoniae strain RJKP36

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NIL00_RS28275 Protein ID WP_001044770.1
Coordinates 43403..43819 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NIL00_RS28270 Protein ID WP_001261282.1
Coordinates 43176..43406 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL00_RS28235 (NIL00_28220) 38399..39178 - 780 WP_013214009.1 site-specific integrase -
NIL00_RS28240 (NIL00_28225) 39362..40366 - 1005 WP_011977814.1 hypothetical protein -
NIL00_RS28245 (NIL00_28230) 40396..40599 - 204 WP_011977813.1 hypothetical protein -
NIL00_RS28250 (NIL00_28235) 40645..41166 - 522 WP_013214008.1 hypothetical protein -
NIL00_RS28255 (NIL00_28240) 41224..41616 - 393 WP_011977811.1 hypothetical protein -
NIL00_RS28260 (NIL00_28245) 41653..42597 - 945 WP_011977810.1 hypothetical protein -
NIL00_RS28265 (NIL00_28250) 42758..43219 - 462 WP_264279106.1 hypothetical protein -
NIL00_RS28270 (NIL00_28255) 43176..43406 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIL00_RS28275 (NIL00_28260) 43403..43819 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NIL00_RS28280 (NIL00_28265) 43893..45455 + 1563 WP_004206609.1 AAA family ATPase -
NIL00_RS28285 (NIL00_28270) 45440..46462 + 1023 WP_000361404.1 helicase UvrD -
NIL00_RS28290 (NIL00_28275) 46718..47414 + 697 WP_024269734.1 IS1 family transposase -
NIL00_RS28295 (NIL00_28280) 47443..47715 + 273 Protein_69 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaKPC-2 - 1..108814 108814


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T250071 WP_001044770.1 NZ_CP100079:43403-43819 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT250071 WP_001261282.1 NZ_CP100079:43176-43406 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References