Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 25540..26065 Replicon plasmid pRJKP36-1
Accession NZ_CP100077
Organism Klebsiella pneumoniae strain RJKP36

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NIL00_RS25720 Protein ID WP_013023785.1
Coordinates 25760..26065 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID A0A1D8K3R4
Locus tag NIL00_RS25715 Protein ID WP_006788213.1
Coordinates 25540..25758 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL00_RS25680 (21060) 21060..21596 + 537 WP_223825639.1 hypothetical protein -
NIL00_RS25685 (21614) 21614..21937 + 324 WP_085842301.1 hypothetical protein -
NIL00_RS25690 (21978) 21978..22394 - 417 WP_032425563.1 type II toxin-antitoxin system VapC family toxin -
NIL00_RS25695 (22391) 22391..22621 - 231 WP_016338373.1 type II toxin-antitoxin system VapB family antitoxin -
NIL00_RS25700 (22839) 22839..23753 - 915 WP_126834912.1 Abi family protein -
NIL00_RS25705 (24046) 24046..24999 - 954 WP_109549184.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
NIL00_RS25710 (25107) 25107..25370 + 264 Protein_32 hypothetical protein -
NIL00_RS25715 (25540) 25540..25758 + 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIL00_RS25720 (25760) 25760..26065 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NIL00_RS25725 (26234) 26234..26629 + 396 WP_017899885.1 hypothetical protein -
NIL00_RS25730 (26656) 26656..26970 + 315 WP_053389906.1 hypothetical protein -
NIL00_RS25735 (26981) 26981..27997 + 1017 WP_017899884.1 hypothetical protein -
NIL00_RS25740 (28195) 28195..28987 + 793 Protein_38 site-specific integrase -
NIL00_RS25745 (29427) 29427..29729 - 303 WP_071571079.1 hypothetical protein -
NIL00_RS25750 (29726) 29726..30352 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrB1 / dfrA14 / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 1..134731 134731


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T250070 WP_013023785.1 NZ_CP100077:25760-26065 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8362.31 Da        Isoelectric Point: 4.7405

>AT250070 WP_006788213.1 NZ_CP100077:25540-25758 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISGLVNRAMQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1D8K3R4

References