Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 21978..22621 Replicon plasmid pRJKP36-1
Accession NZ_CP100077
Organism Klebsiella pneumoniae strain RJKP36

Toxin (Protein)


Gene name vagD Uniprot ID A0A7D6UII7
Locus tag NIL00_RS25690 Protein ID WP_032425563.1
Coordinates 21978..22394 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID R4IT22
Locus tag NIL00_RS25695 Protein ID WP_016338373.1
Coordinates 22391..22621 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL00_RS25670 (17026) 17026..19134 - 2109 WP_016338368.1 peptidase domain-containing ABC transporter -
NIL00_RS25675 (19124) 19124..20401 - 1278 WP_016338369.1 HlyD family secretion protein -
NIL00_RS25680 (21060) 21060..21596 + 537 WP_223825639.1 hypothetical protein -
NIL00_RS25685 (21614) 21614..21937 + 324 WP_085842301.1 hypothetical protein -
NIL00_RS25690 (21978) 21978..22394 - 417 WP_032425563.1 type II toxin-antitoxin system VapC family toxin Toxin
NIL00_RS25695 (22391) 22391..22621 - 231 WP_016338373.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIL00_RS25700 (22839) 22839..23753 - 915 WP_126834912.1 Abi family protein -
NIL00_RS25705 (24046) 24046..24999 - 954 WP_109549184.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
NIL00_RS25710 (25107) 25107..25370 + 264 Protein_32 hypothetical protein -
NIL00_RS25715 (25540) 25540..25758 + 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA -
NIL00_RS25720 (25760) 25760..26065 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
NIL00_RS25725 (26234) 26234..26629 + 396 WP_017899885.1 hypothetical protein -
NIL00_RS25730 (26656) 26656..26970 + 315 WP_053389906.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid qnrB1 / dfrA14 / blaCTX-M-15 / blaTEM-1B / aph(6)-Id / aph(3'')-Ib / sul2 - 1..134731 134731


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15080.56 Da        Isoelectric Point: 8.5403

>T250069 WP_032425563.1 NZ_CP100077:c22394-21978 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8751.77 Da        Isoelectric Point: 4.3533

>AT250069 WP_016338373.1 NZ_CP100077:c22621-22391 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWSSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7D6UII7

Antitoxin

Source ID Structure
AlphaFold DB A0A5Q9LN61

References