Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5152017..5152642 | Replicon | chromosome |
Accession | NZ_CP100076 | ||
Organism | Klebsiella pneumoniae strain RJKP36 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | NIL00_RS24810 | Protein ID | WP_002882817.1 |
Coordinates | 5152017..5152400 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NIL00_RS24815 | Protein ID | WP_004150355.1 |
Coordinates | 5152400..5152642 (-) | Length | 81 a.a. |
Genomic Context
Location: 5149383..5150285 (903 bp)
Type: Others
Protein ID: WP_002882822.1
Type: Others
Protein ID: WP_002882822.1
Location: 5150282..5150917 (636 bp)
Type: Others
Protein ID: WP_002882818.1
Type: Others
Protein ID: WP_002882818.1
Location: 5150914..5151843 (930 bp)
Type: Others
Protein ID: WP_004150358.1
Type: Others
Protein ID: WP_004150358.1
Location: 5152847..5153764 (918 bp)
Type: Others
Protein ID: WP_004181612.1
Type: Others
Protein ID: WP_004181612.1
Location: 5152017..5152400 (384 bp)
Type: Toxin
Protein ID: WP_002882817.1
Type: Toxin
Protein ID: WP_002882817.1
Location: 5152400..5152642 (243 bp)
Type: Antitoxin
Protein ID: WP_004150355.1
Type: Antitoxin
Protein ID: WP_004150355.1
Location: 5153778..5154719 (942 bp)
Type: Others
Protein ID: WP_004178031.1
Type: Others
Protein ID: WP_004178031.1
Location: 5154764..5155201 (438 bp)
Type: Others
Protein ID: WP_002882809.1
Type: Others
Protein ID: WP_002882809.1
Location: 5155198..5156058 (861 bp)
Type: Others
Protein ID: WP_004146232.1
Type: Others
Protein ID: WP_004146232.1
Location: 5156052..5156651 (600 bp)
Type: Others
Protein ID: WP_004151865.1
Type: Others
Protein ID: WP_004151865.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL00_RS24795 (5149383) | 5149383..5150285 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NIL00_RS24800 (5150282) | 5150282..5150917 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
NIL00_RS24805 (5150914) | 5150914..5151843 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NIL00_RS24810 (5152017) | 5152017..5152400 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NIL00_RS24815 (5152400) | 5152400..5152642 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NIL00_RS24820 (5152847) | 5152847..5153764 | + | 918 | WP_004181612.1 | alpha/beta hydrolase | - |
NIL00_RS24825 (5153778) | 5153778..5154719 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
NIL00_RS24830 (5154764) | 5154764..5155201 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
NIL00_RS24835 (5155198) | 5155198..5156058 | - | 861 | WP_004146232.1 | virulence factor BrkB family protein | - |
NIL00_RS24840 (5156052) | 5156052..5156651 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T250067 WP_002882817.1 NZ_CP100076:c5152400-5152017 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |