Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4683290..4683806 | Replicon | chromosome |
Accession | NZ_CP100076 | ||
Organism | Klebsiella pneumoniae strain RJKP36 |
Toxin (Protein)
Gene name | relE | Uniprot ID | R4YAY3 |
Locus tag | NIL00_RS22580 | Protein ID | WP_004178374.1 |
Coordinates | 4683290..4683574 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | NIL00_RS22585 | Protein ID | WP_002886901.1 |
Coordinates | 4683564..4683806 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL00_RS22555 (4678774) | 4678774..4679082 | - | 309 | WP_022631369.1 | PTS sugar transporter subunit IIB | - |
NIL00_RS22560 (4679167) | 4679167..4679340 | + | 174 | WP_032408826.1 | hypothetical protein | - |
NIL00_RS22565 (4679343) | 4679343..4680086 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
NIL00_RS22570 (4680443) | 4680443..4682581 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NIL00_RS22575 (4682822) | 4682822..4683286 | + | 465 | WP_004178375.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NIL00_RS22580 (4683290) | 4683290..4683574 | - | 285 | WP_004178374.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NIL00_RS22585 (4683564) | 4683564..4683806 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NIL00_RS22590 (4683884) | 4683884..4685794 | - | 1911 | WP_004178373.1 | PRD domain-containing protein | - |
NIL00_RS22595 (4685817) | 4685817..4686971 | - | 1155 | WP_004178372.1 | lactonase family protein | - |
NIL00_RS22600 (4687038) | 4687038..4687778 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11155.97 Da Isoelectric Point: 10.3787
>T250065 WP_004178374.1 NZ_CP100076:c4683574-4683290 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A6THG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |