Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3953850..3954469 | Replicon | chromosome |
| Accession | NZ_CP100076 | ||
| Organism | Klebsiella pneumoniae strain RJKP36 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NIL00_RS19145 | Protein ID | WP_002892050.1 |
| Coordinates | 3954251..3954469 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NIL00_RS19140 | Protein ID | WP_002892066.1 |
| Coordinates | 3953850..3954224 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL00_RS19130 (3949002) | 3949002..3950195 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NIL00_RS19135 (3950218) | 3950218..3953364 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NIL00_RS19140 (3953850) | 3953850..3954224 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NIL00_RS19145 (3954251) | 3954251..3954469 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NIL00_RS19150 (3954628) | 3954628..3955194 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NIL00_RS19155 (3955166) | 3955166..3955306 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NIL00_RS19160 (3955327) | 3955327..3955797 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| NIL00_RS19165 (3955772) | 3955772..3957223 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| NIL00_RS19170 (3957324) | 3957324..3958022 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| NIL00_RS19175 (3958019) | 3958019..3958159 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NIL00_RS19180 (3958159) | 3958159..3958422 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T250063 WP_002892050.1 NZ_CP100076:3954251-3954469 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT250063 WP_002892066.1 NZ_CP100076:3953850-3954224 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |