Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 783531..784188 | Replicon | chromosome |
Accession | NZ_CP100076 | ||
Organism | Klebsiella pneumoniae strain RJKP36 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | NIL00_RS03845 | Protein ID | WP_002916310.1 |
Coordinates | 783778..784188 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NIL00_RS03840 | Protein ID | WP_002916312.1 |
Coordinates | 783531..783797 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIL00_RS03815 (778687) | 778687..780120 | - | 1434 | WP_020324925.1 | 6-phospho-beta-glucosidase | - |
NIL00_RS03820 (780239) | 780239..780967 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
NIL00_RS03825 (781017) | 781017..781328 | + | 312 | WP_004144734.1 | N(4)-acetylcytidine aminohydrolase | - |
NIL00_RS03830 (781492) | 781492..782151 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
NIL00_RS03835 (782302) | 782302..783285 | - | 984 | WP_020324927.1 | tRNA-modifying protein YgfZ | - |
NIL00_RS03840 (783531) | 783531..783797 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NIL00_RS03845 (783778) | 783778..784188 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
NIL00_RS03850 (784195) | 784195..784716 | - | 522 | WP_004144730.1 | flavodoxin FldB | - |
NIL00_RS03855 (784817) | 784817..785713 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
NIL00_RS03860 (785736) | 785736..786449 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NIL00_RS03865 (786455) | 786455..788188 | + | 1734 | WP_004149758.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T250057 WP_002916310.1 NZ_CP100076:783778-784188 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |