Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 634478..635157 | Replicon | chromosome |
| Accession | NZ_CP100076 | ||
| Organism | Klebsiella pneumoniae strain RJKP36 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A0C7K7A4 |
| Locus tag | NIL00_RS03090 | Protein ID | WP_020324801.1 |
| Coordinates | 634816..635157 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A0C7KEL2 |
| Locus tag | NIL00_RS03085 | Protein ID | WP_020324792.1 |
| Coordinates | 634478..634795 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIL00_RS03060 (629692) | 629692..632844 | + | 3153 | WP_022631414.1 | AIDA repeat-containing protein | - |
| NIL00_RS03065 (632937) | 632937..633176 | + | 240 | WP_020324820.1 | DUF905 domain-containing protein | - |
| NIL00_RS03070 (633279) | 633279..633737 | + | 459 | WP_020324813.1 | antirestriction protein | - |
| NIL00_RS03075 (633753) | 633753..634229 | + | 477 | WP_020324797.1 | RadC family protein | - |
| NIL00_RS03080 (634238) | 634238..634465 | + | 228 | WP_020324796.1 | DUF987 domain-containing protein | - |
| NIL00_RS03085 (634478) | 634478..634795 | + | 318 | WP_020324792.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NIL00_RS03090 (634816) | 634816..635157 | + | 342 | WP_020324801.1 | TA system toxin CbtA family protein | Toxin |
| NIL00_RS03095 (635273) | 635273..636106 | + | 834 | WP_020324805.1 | DUF4942 domain-containing protein | - |
| NIL00_RS03105 (636409) | 636409..636915 | + | 507 | WP_002917636.1 | G/U mismatch-specific DNA glycosylase | - |
| NIL00_RS03110 (637015) | 637015..638856 | - | 1842 | WP_004174339.1 | RNA polymerase sigma factor RpoD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimA / fimI / fimC / fimD / fimD / fimF / fimG | 591624..636106 | 44482 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12818.91 Da Isoelectric Point: 9.1484
>T250056 WP_020324801.1 NZ_CP100076:634816-635157 [Klebsiella pneumoniae]
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
MKTLPAIISRAAKPCLSPVAVWQMLLTRLLEKHYGLTLNDTPFCDETVIQEHIDAGITLADAVNFLVEKYGLVRIDRNGF
VWQEQSPYLRAVDILRARQATGLLRQSRNNAIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C7K7A4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0C7KEL2 |