Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 6961..7604 Replicon plasmid pRJKP41-1
Accession NZ_CP100073
Organism Klebsiella pneumoniae strain RJKP41

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NIL01_RS26130 Protein ID WP_001044770.1
Coordinates 7188..7604 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NIL01_RS26125 Protein ID WP_001261282.1
Coordinates 6961..7191 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL01_RS26085 (2166) 2166..2468 + 303 WP_004197636.1 hypothetical protein -
NIL01_RS26090 (2924) 2924..3718 - 795 WP_004197635.1 site-specific integrase -
NIL01_RS26095 (3916) 3916..4932 - 1017 WP_017899884.1 hypothetical protein -
NIL01_RS26100 (4943) 4943..5257 - 315 WP_053389906.1 hypothetical protein -
NIL01_RS26105 (5284) 5284..5679 - 396 WP_017899885.1 hypothetical protein -
NIL01_RS26110 (5848) 5848..6153 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB -
NIL01_RS26115 (6155) 6155..6373 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA -
NIL01_RS26120 (6543) 6543..7004 - 462 WP_160880186.1 hypothetical protein -
NIL01_RS26125 (6961) 6961..7191 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NIL01_RS26130 (7188) 7188..7604 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NIL01_RS26135 (7678) 7678..9240 + 1563 WP_004206609.1 AAA family ATPase -
NIL01_RS26140 (9225) 9225..10247 + 1023 WP_000361404.1 helicase UvrD -
NIL01_RS26145 (10503) 10503..11200 + 698 WP_223174630.1 IS1 family transposase -
NIL01_RS26150 (11229) 11229..11501 + 273 Protein_15 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 / rmtB / blaTEM-1B / fosA3 / blaCTX-M-65 / catA2 - 1..164564 164564


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T250046 WP_001044770.1 NZ_CP100073:7188-7604 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT250046 WP_001261282.1 NZ_CP100073:6961-7191 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References