Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 5848..6373 Replicon plasmid pRJKP41-1
Accession NZ_CP100073
Organism Klebsiella pneumoniae strain RJKP41

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag NIL01_RS26110 Protein ID WP_013023785.1
Coordinates 5848..6153 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag NIL01_RS26115 Protein ID WP_001568025.1
Coordinates 6155..6373 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIL01_RS26080 (1543) 1543..2169 + 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -
NIL01_RS26085 (2166) 2166..2468 + 303 WP_004197636.1 hypothetical protein -
NIL01_RS26090 (2924) 2924..3718 - 795 WP_004197635.1 site-specific integrase -
NIL01_RS26095 (3916) 3916..4932 - 1017 WP_017899884.1 hypothetical protein -
NIL01_RS26100 (4943) 4943..5257 - 315 WP_053389906.1 hypothetical protein -
NIL01_RS26105 (5284) 5284..5679 - 396 WP_017899885.1 hypothetical protein -
NIL01_RS26110 (5848) 5848..6153 - 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
NIL01_RS26115 (6155) 6155..6373 - 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
NIL01_RS26120 (6543) 6543..7004 - 462 WP_160880186.1 hypothetical protein -
NIL01_RS26125 (6961) 6961..7191 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin -
NIL01_RS26130 (7188) 7188..7604 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin -
NIL01_RS26135 (7678) 7678..9240 + 1563 WP_004206609.1 AAA family ATPase -
NIL01_RS26140 (9225) 9225..10247 + 1023 WP_000361404.1 helicase UvrD -
NIL01_RS26145 (10503) 10503..11200 + 698 WP_223174630.1 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 / rmtB / blaTEM-1B / fosA3 / blaCTX-M-65 / catA2 - 1..164564 164564


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T250045 WP_013023785.1 NZ_CP100073:c6153-5848 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT250045 WP_001568025.1 NZ_CP100073:c6373-6155 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References