Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 924769..925298 | Replicon | chromosome |
| Accession | NZ_CP099990 | ||
| Organism | Staphylococcus equorum strain PU1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | K7S376 |
| Locus tag | NHN23_RS04390 | Protein ID | WP_002511418.1 |
| Coordinates | 924936..925298 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | J9GY23 |
| Locus tag | NHN23_RS04385 | Protein ID | WP_002507108.1 |
| Coordinates | 924769..924939 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NHN23_RS04360 | 920520..920999 | + | 480 | WP_021339947.1 | PH domain-containing protein | - |
| NHN23_RS04365 | 920992..922497 | + | 1506 | WP_021339948.1 | PH domain-containing protein | - |
| NHN23_RS04370 | 922490..923026 | + | 537 | WP_002507105.1 | PH domain-containing protein | - |
| NHN23_RS04375 | 923059..923409 | + | 351 | WP_021339949.1 | holo-ACP synthase | - |
| NHN23_RS04380 | 923533..924681 | + | 1149 | WP_253345678.1 | alanine racemase | - |
| NHN23_RS04385 | 924769..924939 | + | 171 | WP_002507108.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| NHN23_RS04390 | 924936..925298 | + | 363 | WP_002511418.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NHN23_RS04395 | 925657..926653 | + | 997 | Protein_867 | PP2C family protein-serine/threonine phosphatase | - |
| NHN23_RS04400 | 926733..927059 | + | 327 | WP_002511417.1 | anti-sigma factor antagonist | - |
| NHN23_RS04405 | 927061..927543 | + | 483 | WP_002507113.1 | anti-sigma B factor RsbW | - |
| NHN23_RS04410 | 927518..928288 | + | 771 | WP_002507114.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13432.59 Da Isoelectric Point: 10.2178
>T250028 WP_002511418.1 NZ_CP099990:924936-925298 [Staphylococcus equorum]
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSESKMKEVNVAIDISLGLHNVRNSKS
MMRRGDVYLADLSPVQGSEQGGIRPVVIIQNDTGNKYSPTVIVAAITGRINKAKIPTHVEIEKSKYKLDKDSVILLEQIR
TLDKNRLKEKLTYLSESKMKEVNVAIDISLGLHNVRNSKS
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|