Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2757098..2757777 | Replicon | chromosome |
| Accession | NZ_CP099989 | ||
| Organism | Acinetobacter baumannii strain KBN10P04593 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | NIH92_RS13415 | Protein ID | WP_000838146.1 |
| Coordinates | 2757098..2757280 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | NIH92_RS13420 | Protein ID | WP_000966688.1 |
| Coordinates | 2757373..2757777 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIH92_RS13375 (NIH92_13375) | 2752212..2752616 | + | 405 | WP_000247948.1 | hypothetical protein | - |
| NIH92_RS13380 (NIH92_13380) | 2752588..2752956 | + | 369 | WP_002055488.1 | hypothetical protein | - |
| NIH92_RS13385 (NIH92_13385) | 2752958..2753356 | + | 399 | WP_001251850.1 | phage tail terminator-like protein | - |
| NIH92_RS13390 (NIH92_13390) | 2753358..2753576 | + | 219 | WP_070423369.1 | hypothetical protein | - |
| NIH92_RS13395 (NIH92_13395) | 2753672..2754025 | + | 354 | WP_015451444.1 | hypothetical protein | - |
| NIH92_RS13400 (NIH92_13400) | 2754025..2755173 | + | 1149 | WP_070423372.1 | phage tail protein | - |
| NIH92_RS13405 (NIH92_13405) | 2755270..2756187 | + | 918 | WP_083028177.1 | phage tail tube protein | - |
| NIH92_RS13410 (NIH92_13410) | 2756257..2756772 | + | 516 | WP_038346477.1 | hypothetical protein | - |
| NIH92_RS13415 (NIH92_13415) | 2757098..2757280 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIH92_RS13420 (NIH92_13420) | 2757373..2757777 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIH92_RS13425 (NIH92_13425) | 2757870..2758631 | + | 762 | WP_000910437.1 | hypothetical protein | - |
| NIH92_RS13430 (NIH92_13430) | 2758697..2759074 | + | 378 | WP_016062490.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2676039..2773975 | 97936 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T250026 WP_000838146.1 NZ_CP099989:2757098-2757280 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT250026 WP_000966688.1 NZ_CP099989:2757373-2757777 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|