Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 1923335..1923988 | Replicon | chromosome |
Accession | NZ_CP099989 | ||
Organism | Acinetobacter baumannii strain KBN10P04593 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | NIH92_RS09325 | Protein ID | WP_000607077.1 |
Coordinates | 1923599..1923988 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | V5V966 |
Locus tag | NIH92_RS09320 | Protein ID | WP_001288210.1 |
Coordinates | 1923335..1923592 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIH92_RS09300 (NIH92_09300) | 1918851..1919858 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
NIH92_RS09305 (NIH92_09305) | 1919877..1920254 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
NIH92_RS09310 (NIH92_09310) | 1920436..1921926 | + | 1491 | WP_000415125.1 | NAD(P)/FAD-dependent oxidoreductase | - |
NIH92_RS09315 (NIH92_09315) | 1921975..1923147 | - | 1173 | WP_001190542.1 | acyl-CoA dehydrogenase family protein | - |
NIH92_RS09320 (NIH92_09320) | 1923335..1923592 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
NIH92_RS09325 (NIH92_09325) | 1923599..1923988 | + | 390 | WP_000607077.1 | membrane protein | Toxin |
NIH92_RS09330 (NIH92_09330) | 1924758..1925843 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
NIH92_RS09335 (NIH92_09335) | 1925921..1926487 | + | 567 | WP_000651538.1 | rhombosortase | - |
NIH92_RS09340 (NIH92_09340) | 1926675..1928870 | + | 2196 | WP_001158906.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15552.88 Da Isoelectric Point: 10.4313
>T250025 WP_000607077.1 NZ_CP099989:1923599-1923988 [Acinetobacter baumannii]
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
MINHLNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYKSQNTV
SRVKILKIIDCQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|