Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 1039810..1040303 Replicon chromosome
Accession NZ_CP099979
Organism Enterococcus faecium strain WN-18

Toxin (Protein)


Gene name relE Uniprot ID A0A133MTG0
Locus tag NHN13_RS04965 Protein ID WP_002329323.1
Coordinates 1040037..1040303 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A829AAJ0
Locus tag NHN13_RS04960 Protein ID WP_002329324.1
Coordinates 1039810..1040040 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHN13_RS04930 (NHN13_04925) 1034814..1035581 + 768 WP_002329331.1 MurR/RpiR family transcriptional regulator -
NHN13_RS04935 (NHN13_04930) 1035582..1036025 + 444 WP_002329330.1 hypothetical protein -
NHN13_RS04940 (NHN13_04935) 1036197..1036825 - 629 Protein_978 glutamine amidotransferase -
NHN13_RS04945 (NHN13_04940) 1037472..1038431 - 960 WP_002293280.1 IS30-like element IS6770 family transposase -
NHN13_RS04950 (NHN13_04945) 1038681..1038986 + 306 WP_002329327.1 hypothetical protein -
NHN13_RS04955 (NHN13_04950) 1038999..1039334 + 336 WP_002329326.1 hypothetical protein -
NHN13_RS04960 (NHN13_04955) 1039810..1040040 + 231 WP_002329324.1 DUF6290 family protein Antitoxin
NHN13_RS04965 (NHN13_04960) 1040037..1040303 + 267 WP_002329323.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NHN13_RS04970 (NHN13_04965) 1040555..1040782 + 228 WP_002329322.1 hypothetical protein -
NHN13_RS04975 (NHN13_04970) 1040798..1041964 + 1167 WP_002329321.1 radical SAM family heme chaperone HemW -
NHN13_RS04980 (NHN13_04975) 1042197..1043240 + 1044 WP_002329320.1 heat-inducible transcriptional repressor HrcA -
NHN13_RS04985 (NHN13_04980) 1043334..1043897 + 564 WP_002292135.1 nucleotide exchange factor GrpE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1037472..1038431 959


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-87)

Antitoxin

Protein of unknown function DUF6290

(1-71)


Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10617.27 Da        Isoelectric Point: 10.1925

>T250024 WP_002329323.1 NZ_CP099979:1040037-1040303 [Enterococcus faecium]
MTYRLEFTPEIQKQLRKMDKHQATLIVRWLYQHIDGIDDPRKFGKGLTANRSGQWRYRIGKYRVLVEIEDDQMVVIAIQV
GHRRNIYD

Download         Length: 267 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8863.97 Da        Isoelectric Point: 4.1938

>AT250024 WP_002329324.1 NZ_CP099979:1039810-1040040 [Enterococcus faecium]
MAMITVRVSDAEKEWLSYMAEFYGITLSELLKTYSMEQLEDEYDRQTAEIAHKHWVESGKTTVSMEEILHEFGGLE

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A133MTG0

Antitoxin

Source ID Structure
AlphaFold DB A0A829AAJ0

References