Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/COG3657-dnstrm_HI1420 |
Location | 2326816..2327430 | Replicon | chromosome |
Accession | NZ_CP099975 | ||
Organism | Halomonas sp. Y3 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NHL60_RS11125 | Protein ID | WP_253443270.1 |
Coordinates | 2326816..2327112 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | NHL60_RS11130 | Protein ID | WP_253443271.1 |
Coordinates | 2327116..2327430 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHL60_RS11105 | 2322876..2323544 | + | 669 | WP_253443269.1 | IS4 family transposase | - |
NHL60_RS11110 | 2323572..2324345 | - | 774 | WP_133483961.1 | IS21-like element helper ATPase IstB | - |
NHL60_RS11115 | 2324338..2325828 | - | 1491 | WP_253452147.1 | IS21 family transposase | - |
NHL60_RS11120 | 2325964..2326515 | + | 552 | WP_253452150.1 | transposase | - |
NHL60_RS11125 | 2326816..2327112 | + | 297 | WP_253443270.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NHL60_RS11130 | 2327116..2327430 | + | 315 | WP_253443271.1 | putative addiction module antidote protein | Antitoxin |
NHL60_RS11135 | 2328373..2329549 | + | 1177 | Protein_2164 | group II intron reverse transcriptase/maturase | - |
NHL60_RS11140 | 2329618..2330994 | - | 1377 | WP_253443272.1 | IS4 family transposase | - |
NHL60_RS11145 | 2331139..2331606 | - | 468 | WP_253443273.1 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2319954..2332505 | 12551 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11026.86 Da Isoelectric Point: 10.5786
>T250020 WP_253443270.1 NZ_CP099975:2326816-2327112 [Halomonas sp. Y3]
MIELIKTDVFDRWLRSLRDTRARAKITVRLRRLSLGNPGDVKPVGEGISELRIPHGPGYRVYYLTRGPIVVVLLCGGDKG
SQPSDIEQAKAIAKQWKE
MIELIKTDVFDRWLRSLRDTRARAKITVRLRRLSLGNPGDVKPVGEGISELRIPHGPGYRVYYLTRGPIVVVLLCGGDKG
SQPSDIEQAKAIAKQWKE
Download Length: 297 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|