Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1985534..1986139 | Replicon | chromosome |
Accession | NZ_CP099975 | ||
Organism | Halomonas sp. Y3 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NHL60_RS09435 | Protein ID | WP_253451726.1 |
Coordinates | 1985534..1985716 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NHL60_RS09440 | Protein ID | WP_253451728.1 |
Coordinates | 1985735..1986139 (+) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHL60_RS09415 | 1980883..1981923 | + | 1041 | WP_253451716.1 | protease SohB | - |
NHL60_RS09420 | 1981920..1982243 | - | 324 | WP_253451718.1 | metalloregulator ArsR/SmtB family transcription factor | - |
NHL60_RS09425 | 1982558..1984468 | + | 1911 | WP_253451720.1 | propionyl-CoA synthetase | - |
NHL60_RS09430 | 1984706..1985395 | + | 690 | WP_253451723.1 | 7-cyano-7-deazaguanine/7-aminomethyl-7- deazaguanine transporter | - |
NHL60_RS09435 | 1985534..1985716 | + | 183 | WP_253451726.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NHL60_RS09440 | 1985735..1986139 | + | 405 | WP_253451728.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NHL60_RS09445 | 1986252..1987031 | + | 780 | WP_253451731.1 | alpha/beta fold hydrolase | - |
NHL60_RS09450 | 1987032..1988432 | - | 1401 | WP_253451734.1 | 3'-5' exonuclease family protein | - |
NHL60_RS09455 | 1988432..1989607 | - | 1176 | WP_253451738.1 | ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6679.75 Da Isoelectric Point: 11.0468
>T250019 WP_253451726.1 NZ_CP099975:1985534-1985716 [Halomonas sp. Y3]
VKSSELIKELEAAGWVLDRIRGSHHVFKHPERSGAIPVPHPKKDLPRGTVHQIRKQAGLA
VKSSELIKELEAAGWVLDRIRGSHHVFKHPERSGAIPVPHPKKDLPRGTVHQIRKQAGLA
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14686.55 Da Isoelectric Point: 4.3945
>AT250019 WP_253451728.1 NZ_CP099975:1985735-1986139 [Halomonas sp. Y3]
MQYPIAIEWGDDNTATGIVFPDIPGAISAGDSPEEAYDNAVEAAQIVLQELVSRGESVPKPGKINEHRRNPDFEGWGWGM
IDIDLTPYLGKTEKVTVTLPGIVVRQIDEYVTLHGIKSRSAFLSNAALEKLQHV
MQYPIAIEWGDDNTATGIVFPDIPGAISAGDSPEEAYDNAVEAAQIVLQELVSRGESVPKPGKINEHRRNPDFEGWGWGM
IDIDLTPYLGKTEKVTVTLPGIVVRQIDEYVTLHGIKSRSAFLSNAALEKLQHV
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|