Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) PumAB/COG3657-dnstrm_HI1420
Location 1924862..1925454 Replicon chromosome
Accession NZ_CP099975
Organism Halomonas sp. Y3

Toxin (Protein)


Gene name PumA Uniprot ID -
Locus tag NHL60_RS09135 Protein ID WP_253451618.1
Coordinates 1924862..1925161 (+) Length 100 a.a.

Antitoxin (Protein)


Gene name PumB Uniprot ID -
Locus tag NHL60_RS09140 Protein ID WP_253451620.1
Coordinates 1925158..1925454 (+) Length 99 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NHL60_RS09100 1920838..1920996 + 159 WP_253451614.1 ElyC/SanA/YdcF family protein -
NHL60_RS09105 1921042..1921251 + 210 WP_169957623.1 hypothetical protein -
NHL60_RS09110 1921248..1921604 + 357 WP_253445286.1 IS66 family insertion sequence element accessory protein TnpB -
NHL60_RS09115 1921647..1922783 + 1137 Protein_1766 IS66 family transposase -
NHL60_RS09120 1922899..1924017 + 1119 WP_253452053.1 ISAs1 family transposase -
NHL60_RS09125 1924078..1924488 + 411 Protein_1768 transposase -
NHL60_RS09130 1924530..1924724 + 195 WP_253451616.1 hypothetical protein -
NHL60_RS09135 1924862..1925161 + 300 WP_253451618.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NHL60_RS09140 1925158..1925454 + 297 WP_253451620.1 putative addiction module antidote protein Antitoxin
NHL60_RS09145 1925476..1925919 - 444 WP_253451622.1 DUF86 domain-containing protein -
NHL60_RS09150 1925939..1926340 - 402 WP_253451624.1 nucleotidyltransferase domain-containing protein -
NHL60_RS09155 1926466..1927257 - 792 WP_253451626.1 3'(2'),5'-bisphosphate nucleotidase CysQ -
NHL60_RS09160 1927263..1927982 + 720 WP_253451628.1 plasmid pRiA4b ORF-3 family protein -
NHL60_RS09165 1928233..1928973 - 741 WP_089680926.1 IS21-like element helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1919762..1942323 22561
- inside IScluster/Tn - - 1921248..1938399 17151


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Addiction module killer protein, predicted

(3-96)

Antitoxin

Uncharacterized protein HI1420

(7-93)


Sequences

Toxin        


Download         Length: 100 a.a.        Molecular weight: 11303.97 Da        Isoelectric Point: 10.2220

>T250018 WP_253451618.1 NZ_CP099975:1924862-1925161 [Halomonas sp. Y3]
MLDIKQTDTYRKWERKLRDQRAKALIAARVFRLANGLPGDVQPVGQGVSELRIHHGPGYRIYFKQRGSEIVILLCGGDKS
TQQRDIETAQRLAAEWEAL

Download         Length: 300 bp

Antitoxin


Download         Length: 99 a.a.        Molecular weight: 10506.94 Da        Isoelectric Point: 4.4805

>AT250018 WP_253451620.1 NZ_CP099975:1925158-1925454 [Halomonas sp. Y3]
MSDKIFDYDPAAALESEEAIAVFLADALETGDSAYIAKAMGVVARAKGMSELARETGLSREQLYRSFSEQGNPTLKTMLA
VMRALGVDLTARPHEPAA

Download         Length: 297 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References