Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4179517..4180298 | Replicon | chromosome |
Accession | NZ_CP099973 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain SE006 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B5R980 |
Locus tag | NHL55_RS20455 | Protein ID | WP_000626100.1 |
Coordinates | 4179517..4180008 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | NHL55_RS20460 | Protein ID | WP_001110452.1 |
Coordinates | 4180005..4180298 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NHL55_RS20420 (4174977) | 4174977..4175324 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
NHL55_RS20425 (4175300) | 4175300..4177003 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
NHL55_RS20430 (4177040) | 4177040..4177615 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
NHL55_RS20440 (4177886) | 4177886..4177960 | - | 75 | Protein_3994 | helix-turn-helix domain-containing protein | - |
NHL55_RS20445 (4178340) | 4178340..4178417 | + | 78 | Protein_3995 | porin family protein | - |
NHL55_RS20450 (4178517) | 4178517..4179269 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
NHL55_RS20455 (4179517) | 4179517..4180008 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
NHL55_RS20460 (4180005) | 4180005..4180298 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
NHL55_RS20465 (4180615) | 4180615..4180836 | + | 222 | WP_001576552.1 | hypothetical protein | - |
NHL55_RS20470 (4181102) | 4181102..4181977 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
NHL55_RS20475 (4181974) | 4181974..4182261 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
NHL55_RS20480 (4182254) | 4182254..4182436 | - | 183 | WP_001676222.1 | ATP-binding cassette domain-containing protein | - |
NHL55_RS20485 (4182561) | 4182561..4182809 | + | 249 | Protein_4003 | Ig-like domain-containing protein | - |
NHL55_RS20490 (4182921) | 4182921..4183052 | + | 132 | Protein_4004 | hypothetical protein | - |
NHL55_RS20495 (4183346) | 4183346..4184251 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T250013 WP_000626100.1 NZ_CP099973:c4180008-4179517 [Salmonella enterica subsp. enterica serovar Enteritidis]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT250013 WP_001110452.1 NZ_CP099973:c4180298-4180005 [Salmonella enterica subsp. enterica serovar Enteritidis]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656IQ80 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5I1DGA4 |