Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 1235742..1236339 | Replicon | chromosome |
Accession | NZ_CP099968 | ||
Organism | Brucella pseudintermedia strain ASAG-D25 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NIK97_RS17885 | Protein ID | WP_119039412.1 |
Coordinates | 1236034..1236339 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NIK97_RS17880 | Protein ID | WP_119039410.1 |
Coordinates | 1235742..1236047 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIK97_RS17845 (NIK97_17810) | 1231615..1232760 | + | 1146 | WP_235925445.1 | MFS transporter | - |
NIK97_RS17850 (NIK97_17815) | 1232762..1233847 | + | 1086 | WP_119039402.1 | transporter substrate-binding domain-containing protein | - |
NIK97_RS17855 (NIK97_17820) | 1233909..1234313 | - | 405 | WP_119039404.1 | type II toxin-antitoxin system VapC family toxin | - |
NIK97_RS17860 (NIK97_17825) | 1234319..1234561 | - | 243 | WP_119039406.1 | type II toxin-antitoxin system VapB family antitoxin | - |
NIK97_RS17865 (NIK97_17830) | 1234763..1234939 | - | 177 | WP_162995063.1 | hypothetical protein | - |
NIK97_RS17870 (NIK97_17835) | 1234923..1235318 | - | 396 | WP_119040851.1 | hypothetical protein | - |
NIK97_RS17875 (NIK97_17840) | 1235345..1235668 | - | 324 | WP_119039408.1 | helix-turn-helix transcriptional regulator | - |
NIK97_RS17880 (NIK97_17845) | 1235742..1236047 | - | 306 | WP_119039410.1 | putative addiction module antidote protein | Antitoxin |
NIK97_RS17885 (NIK97_17850) | 1236034..1236339 | - | 306 | WP_119039412.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NIK97_RS17890 (NIK97_17855) | 1236445..1238364 | - | 1920 | WP_119039414.1 | ParB/RepB/Spo0J family partition protein | - |
NIK97_RS17895 (NIK97_17860) | 1238765..1239187 | + | 423 | WP_119039416.1 | hypothetical protein | - |
NIK97_RS17900 (NIK97_17865) | 1239289..1239576 | - | 288 | WP_119039418.1 | hypothetical protein | - |
NIK97_RS17905 (NIK97_17870) | 1239872..1240144 | + | 273 | WP_119039420.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | htpB | 1105459..1331078 | 225619 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11779.50 Da Isoelectric Point: 9.3910
>T249995 WP_119039412.1 NZ_CP099968:c1236339-1236034 [Brucella pseudintermedia]
MLTIKRTTIFIDWLKGLKDRRAVARIAMRIDRFESGNPGHVRDVGDGVGEMKIDYGPGYRVYYVRREKTIYLLLCGGDKR
TQDRDIAEAKRIAKEWTDEED
MLTIKRTTIFIDWLKGLKDRRAVARIAMRIDRFESGNPGHVRDVGDGVGEMKIDYGPGYRVYYVRREKTIYLLLCGGDKR
TQDRDIAEAKRIAKEWTDEED
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|