Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1289639..1290288 | Replicon | chromosome |
Accession | NZ_CP099967 | ||
Organism | Brucella pseudintermedia strain ASAG-D25 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NIK97_RS06250 | Protein ID | WP_144897092.1 |
Coordinates | 1289639..1290037 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NIK97_RS06255 | Protein ID | WP_121981713.1 |
Coordinates | 1290037..1290288 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIK97_RS06225 (NIK97_06210) | 1284942..1285718 | + | 777 | WP_176022914.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
NIK97_RS06230 (NIK97_06215) | 1285895..1286866 | - | 972 | WP_121985861.1 | 2-hydroxyacid dehydrogenase | - |
NIK97_RS06235 (NIK97_06220) | 1286957..1287976 | - | 1020 | WP_006471199.1 | LacI family DNA-binding transcriptional regulator | - |
NIK97_RS06240 (NIK97_06225) | 1288186..1288677 | - | 492 | WP_121985860.1 | MarR family transcriptional regulator | - |
NIK97_RS06245 (NIK97_06230) | 1288847..1289629 | + | 783 | WP_121985859.1 | creatininase family protein | - |
NIK97_RS06250 (NIK97_06235) | 1289639..1290037 | - | 399 | WP_144897092.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NIK97_RS06255 (NIK97_06240) | 1290037..1290288 | - | 252 | WP_121981713.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NIK97_RS06260 (NIK97_06245) | 1290523..1291695 | + | 1173 | WP_174813501.1 | GTP-binding protein | - |
NIK97_RS06265 (NIK97_06250) | 1291781..1292755 | + | 975 | WP_121981711.1 | WD40 repeat domain-containing protein | - |
NIK97_RS06270 (NIK97_06255) | 1292900..1293778 | - | 879 | WP_121985856.1 | alpha/beta hydrolase | - |
NIK97_RS06275 (NIK97_06260) | 1294123..1295082 | + | 960 | WP_121985855.1 | protein-methionine-sulfoxide reductase catalytic subunit MsrP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 13966.20 Da Isoelectric Point: 7.1658
>T249994 WP_144897092.1 NZ_CP099967:c1290037-1289639 [Brucella pseudintermedia]
MRYMLDTNIISDLVKNPAGSVAGHIRRVGADAVCTSIIVAAELRYGVLKKGSPALAERVEAILREIPVLPFDVPADAKYG
ALRAALEAKGQPIGGNNLLIAAHAATLGKTMVTANVSEFGRVSELSVENWLE
MRYMLDTNIISDLVKNPAGSVAGHIRRVGADAVCTSIIVAAELRYGVLKKGSPALAERVEAILREIPVLPFDVPADAKYG
ALRAALEAKGQPIGGNNLLIAAHAATLGKTMVTANVSEFGRVSELSVENWLE
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|