Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 3830092..3830668 | Replicon | chromosome |
| Accession | NZ_CP099965 | ||
| Organism | Halomonas sp. DN3 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NKF27_RS16470 | Protein ID | WP_253553357.1 |
| Coordinates | 3830375..3830668 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NKF27_RS16465 | Protein ID | WP_253553354.1 |
| Coordinates | 3830092..3830388 (+) | Length | 99 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NKF27_RS16445 (NKF27_16445) | 3825210..3827285 | + | 2076 | WP_253553334.1 | GGDEF domain-containing protein | - |
| NKF27_RS16450 (NKF27_16450) | 3827372..3827824 | - | 453 | WP_253553337.1 | tRNA adenosine(34) deaminase TadA | - |
| NKF27_RS16455 (NKF27_16455) | 3827947..3828762 | + | 816 | WP_108132364.1 | acyl-CoA thioesterase II | - |
| NKF27_RS16460 (NKF27_16460) | 3828883..3829203 | - | 321 | WP_253553351.1 | DNA-binding protein | - |
| NKF27_RS16465 (NKF27_16465) | 3830092..3830388 | + | 297 | WP_253553354.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NKF27_RS16470 (NKF27_16470) | 3830375..3830668 | + | 294 | WP_253553357.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NKF27_RS16475 (NKF27_16475) | 3830672..3831004 | + | 333 | WP_253553360.1 | Rha family transcriptional regulator | - |
| NKF27_RS16480 (NKF27_16480) | 3831027..3831380 | - | 354 | WP_253553363.1 | DUF488 family protein | - |
| NKF27_RS16485 (NKF27_16485) | 3831579..3831788 | - | 210 | WP_108132360.1 | hypothetical protein | - |
| NKF27_RS16490 (NKF27_16490) | 3831878..3832801 | - | 924 | WP_253553366.1 | ectoine hydroxylase | - |
| NKF27_RS16495 (NKF27_16495) | 3832980..3833726 | + | 747 | WP_253553368.1 | Crp/Fnr family transcriptional regulator | - |
| NKF27_RS16500 (NKF27_16500) | 3834005..3834706 | + | 702 | WP_108132359.1 | GntR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11212.09 Da Isoelectric Point: 8.4716
>T249993 WP_253553357.1 NZ_CP099965:3830375-3830668 [Halomonas sp. DN3]
MVKIEWSILALKDASGIVEYISEDTPDAALKLFHHIKNKVDRLPDHPKLYKPGREPRTREMVVTDNYIVVYRESEALITI
LRVLHAAQKMALESKKE
MVKIEWSILALKDASGIVEYISEDTPDAALKLFHHIKNKVDRLPDHPKLYKPGREPRTREMVVTDNYIVVYRESEALITI
LRVLHAAQKMALESKKE
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|