Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 2186083..2186552 Replicon chromosome
Accession NZ_CP099965
Organism Halomonas sp. DN3

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag NKF27_RS09450 Protein ID WP_253556446.1
Coordinates 2186328..2186552 (+) Length 75 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag NKF27_RS09445 Protein ID WP_253556239.1
Coordinates 2186083..2186280 (+) Length 66 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NKF27_RS09420 (NKF27_09420) 2181256..2182296 + 1041 WP_253556235.1 LacI family DNA-binding transcriptional regulator -
NKF27_RS09425 (NKF27_09425) 2182357..2182542 - 186 WP_253556445.1 hypothetical protein -
NKF27_RS09430 (NKF27_09430) 2182810..2184060 - 1251 WP_231498723.1 TRAP transporter large permease -
NKF27_RS09435 (NKF27_09435) 2184060..2184560 - 501 WP_253556237.1 TRAP transporter small permease -
NKF27_RS09440 (NKF27_09440) 2184561..2185598 - 1038 WP_108133743.1 TRAP transporter substrate-binding protein -
NKF27_RS09445 (NKF27_09445) 2186083..2186280 + 198 WP_253556239.1 stability determinant Antitoxin
NKF27_RS09450 (NKF27_09450) 2186328..2186552 + 225 WP_253556446.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NKF27_RS09455 (NKF27_09455) 2186646..2188265 - 1620 WP_253556241.1 glucan biosynthesis protein D -
NKF27_RS09460 (NKF27_09460) 2188534..2189595 + 1062 WP_253556242.1 HlyD family secretion protein -
NKF27_RS09465 (NKF27_09465) 2189585..2190712 + 1128 WP_253556243.1 DUF2955 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-73)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 75 a.a.        Molecular weight: 8387.60 Da        Isoelectric Point: 8.6282

>T249991 WP_253556446.1 NZ_CP099965:2186328-2186552 [Halomonas sp. DN3]
VISYIAERDPQAALRLRSRLESAVTSVAEHPFLHQVGRVPGTREIVVHPNFIVIYQVTDRIEVTAVVHARQNYP

Download         Length: 225 bp

Antitoxin


Download         Length: 66 a.a.        Molecular weight: 7516.38 Da        Isoelectric Point: 5.5959

>AT249991 WP_253556239.1 NZ_CP099965:2186083-2186280 [Halomonas sp. DN3]
MTTKLDPIISEFETQEQAESHDRWLREKVQRSIDHPGQGMSHDQVMAKVDIIINDARKRRGGEEA

Download         Length: 198 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References