Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 305005..305805 | Replicon | chromosome |
| Accession | NZ_CP099914 | ||
| Organism | Escherichia albertii strain 104_2_TS_A | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | B1EHN9 |
| Locus tag | NIY84_RS01415 | Protein ID | WP_000342453.1 |
| Coordinates | 305278..305805 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | B1EHP0 |
| Locus tag | NIY84_RS01410 | Protein ID | WP_001277106.1 |
| Coordinates | 305005..305271 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY84_RS01385 (300726) | 300726..301580 | - | 855 | WP_000370584.1 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| NIY84_RS01390 (301573) | 301573..302319 | - | 747 | WP_000151888.1 | PTS sugar transporter subunit IIC | - |
| NIY84_RS01395 (302336) | 302336..302821 | - | 486 | WP_000029259.1 | PTS sugar transporter subunit IIB | - |
| NIY84_RS01400 (302828) | 302828..303229 | - | 402 | WP_001071334.1 | PTS sugar transporter subunit IIA | - |
| NIY84_RS01405 (303752) | 303752..304855 | + | 1104 | WP_010319184.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| NIY84_RS01410 (305005) | 305005..305271 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| NIY84_RS01415 (305278) | 305278..305805 | + | 528 | WP_000342453.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| NIY84_RS01420 (305802) | 305802..306185 | - | 384 | WP_000778774.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| NIY84_RS01425 (306609) | 306609..307718 | + | 1110 | WP_256879195.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NIY84_RS01430 (307766) | 307766..308692 | + | 927 | WP_001295111.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NIY84_RS01435 (308689) | 308689..309966 | + | 1278 | WP_256879194.1 | branched chain amino acid ABC transporter permease LivM | - |
| NIY84_RS01440 (309963) | 309963..310730 | + | 768 | WP_000082101.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19676.58 Da Isoelectric Point: 6.9585
>T249970 WP_000342453.1 NZ_CP099914:305278-305805 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLVAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|