Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
Location | 4405815..4406850 | Replicon | chromosome |
Accession | NZ_CP099912 | ||
Organism | Escherichia albertii strain 105_1_LWG_A |
Toxin (Protein)
Gene name | panT | Uniprot ID | - |
Locus tag | NIY85_RS21895 | Protein ID | WP_256876785.1 |
Coordinates | 4405815..4406354 (-) | Length | 180 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | A0A839B6W4 |
Locus tag | NIY85_RS21900 | Protein ID | WP_000287252.1 |
Coordinates | 4406377..4406850 (-) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY85_RS21850 (4401188) | 4401188..4401670 | + | 483 | WP_059216138.1 | siphovirus Gp157 family protein | - |
NIY85_RS21855 (4401682) | 4401682..4401996 | + | 315 | WP_059216137.1 | hypothetical protein | - |
NIY85_RS21860 (4402013) | 4402013..4402177 | + | 165 | Protein_4281 | DUF2737 family protein | - |
NIY85_RS21865 (4402174) | 4402174..4402734 | + | 561 | WP_059238939.1 | hypothetical protein | - |
NIY85_RS21870 (4402951) | 4402951..4403610 | + | 660 | WP_059238951.1 | ead/Ea22-like family protein | - |
NIY85_RS21875 (4403612) | 4403612..4403790 | + | 179 | Protein_4284 | hypothetical protein | - |
NIY85_RS21880 (4404124) | 4404124..4404903 | + | 780 | WP_256876784.1 | DUF551 domain-containing protein | - |
NIY85_RS21885 (4404903) | 4404903..4405475 | + | 573 | WP_001061339.1 | 3'-5' exonuclease | - |
NIY85_RS21890 (4405512) | 4405512..4405781 | + | 270 | WP_001093912.1 | pyocin activator PrtN family protein | - |
NIY85_RS21895 (4405815) | 4405815..4406354 | - | 540 | WP_256876785.1 | hypothetical protein | Toxin |
NIY85_RS21900 (4406377) | 4406377..4406850 | - | 474 | WP_000287252.1 | DUF4065 domain-containing protein | Antitoxin |
NIY85_RS21905 (4407373) | 4407373..4407888 | + | 516 | WP_002460756.1 | zinc uptake transcriptional repressor Zur | - |
NIY85_RS21910 (4407929) | 4407929..4408138 | - | 210 | WP_001030604.1 | CsbD family protein | - |
NIY85_RS21915 (4408254) | 4408254..4409579 | - | 1326 | WP_025237884.1 | MATE family efflux transporter DinF | - |
NIY85_RS21920 (4409654) | 4409654..4410262 | - | 609 | WP_256876786.1 | transcriptional repressor LexA | - |
NIY85_RS21925 (4410372) | 4410372..4410740 | - | 369 | WP_000002912.1 | diacylglycerol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4380713..4418825 | 38112 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 180 a.a. Molecular weight: 19749.07 Da Isoelectric Point: 4.4481
>T249964 WP_256876785.1 NZ_CP099912:c4406354-4405815 [Escherichia albertii]
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKPPVEAIVALLGTSTISI
VGLVVSGLFKSRKDSDKEK
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKPPVEAIVALLGTSTISI
VGLVVSGLFKSRKDSDKEK
Download Length: 540 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17298.80 Da Isoelectric Point: 8.4143
>AT249964 WP_000287252.1 NZ_CP099912:c4406850-4406377 [Escherichia albertii]
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|