Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3464198..3464816 | Replicon | chromosome |
| Accession | NZ_CP099912 | ||
| Organism | Escherichia albertii strain 105_1_LWG_A | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NIY85_RS17240 | Protein ID | WP_001280991.1 |
| Coordinates | 3464598..3464816 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | NIY85_RS17235 | Protein ID | WP_000344798.1 |
| Coordinates | 3464198..3464572 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY85_RS17225 (3459278) | 3459278..3460471 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NIY85_RS17230 (3460494) | 3460494..3463643 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| NIY85_RS17235 (3464198) | 3464198..3464572 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| NIY85_RS17240 (3464598) | 3464598..3464816 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NIY85_RS17245 (3464993) | 3464993..3465550 | + | 558 | WP_025237467.1 | maltose O-acetyltransferase | - |
| NIY85_RS17250 (3465657) | 3465657..3466127 | + | 471 | WP_000136188.1 | YlaC family protein | - |
| NIY85_RS17255 (3466291) | 3466291..3467841 | + | 1551 | WP_256876460.1 | EAL domain-containing protein | - |
| NIY85_RS17260 (3467879) | 3467879..3468232 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| NIY85_RS17270 (3468613) | 3468613..3468924 | + | 312 | WP_256876461.1 | MGMT family protein | - |
| NIY85_RS17275 (3468954) | 3468954..3469526 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249957 WP_001280991.1 NZ_CP099912:3464598-3464816 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT249957 WP_000344798.1 NZ_CP099912:3464198-3464572 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|