Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 138562..139174 | Replicon | chromosome |
Accession | NZ_CP099912 | ||
Organism | Escherichia albertii strain 105_1_LWG_A |
Toxin (Protein)
Gene name | hicA | Uniprot ID | U9YXE2 |
Locus tag | NIY85_RS00610 | Protein ID | WP_000833473.1 |
Coordinates | 138562..138747 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | L4IWR9 |
Locus tag | NIY85_RS00615 | Protein ID | WP_000499744.1 |
Coordinates | 138764..139174 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY85_RS00595 (134026) | 134026..135321 | + | 1296 | WP_025238096.1 | Fic family protein | - |
NIY85_RS00600 (135429) | 135429..136967 | + | 1539 | WP_256876564.1 | aldehyde dehydrogenase AldB | - |
NIY85_RS00605 (137008) | 137008..138087 | - | 1080 | WP_025238097.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
NIY85_RS00610 (138562) | 138562..138747 | + | 186 | WP_000833473.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NIY85_RS00615 (138764) | 138764..139174 | + | 411 | WP_000499744.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NIY85_RS00620 (139246) | 139246..141210 | - | 1965 | Protein_123 | glycoside hydrolase family 127 protein | - |
NIY85_RS00625 (141221) | 141221..142621 | - | 1401 | WP_025238099.1 | MFS transporter | - |
NIY85_RS00630 (142847) | 142847..143662 | + | 816 | WP_025238100.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6800.89 Da Isoelectric Point: 11.7053
>T249943 WP_000833473.1 NZ_CP099912:138562-138747 [Escherichia albertii]
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSHHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15241.15 Da Isoelectric Point: 4.5486
>AT249943 WP_000499744.1 NZ_CP099912:138764-139174 [Escherichia albertii]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDNAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|