Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 80501..81144 | Replicon | plasmid plas1 |
| Accession | NZ_CP099911 | ||
| Organism | Escherichia albertii strain 110_1_TBG_A | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | - |
| Locus tag | NIY87_RS24085 | Protein ID | WP_256876211.1 |
| Coordinates | 80728..81144 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | - |
| Locus tag | NIY87_RS24080 | Protein ID | WP_256876210.1 |
| Coordinates | 80501..80731 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY87_RS24055 (76574) | 76574..77101 | - | 528 | WP_000203268.1 | colicin B immunity protein | - |
| NIY87_RS24060 (77344) | 77344..78159 | + | 816 | WP_000449473.1 | lipid II-degrading bacteriocin colicin M | - |
| NIY87_RS24065 (78209) | 78209..78562 | - | 354 | WP_000864812.1 | colicin M immunity protein | - |
| NIY87_RS24070 (78735) | 78735..79517 | - | 783 | WP_021533580.1 | site-specific integrase | - |
| NIY87_RS24075 (79519) | 79519..79932 | - | 414 | WP_000465043.1 | hypothetical protein | - |
| NIY87_RS24080 (80501) | 80501..80731 | + | 231 | WP_256876210.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NIY87_RS24085 (80728) | 80728..81144 | + | 417 | WP_256876211.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NIY87_RS24090 (81284) | 81284..82264 | + | 981 | WP_256876212.1 | hypothetical protein | - |
| NIY87_RS24095 (82472) | 82472..84043 | - | 1572 | WP_256876213.1 | ATP-binding protein | - |
| NIY87_RS24100 (84362) | 84362..84631 | + | 270 | WP_256876214.1 | hypothetical protein | - |
| NIY87_RS24105 (84619) | 84619..85215 | + | 597 | WP_256876215.1 | hypothetical protein | - |
| NIY87_RS24110 (85752) | 85752..86093 | + | 342 | Protein_99 | protein RepA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | espL2 | 1..89096 | 89096 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15080.41 Da Isoelectric Point: 6.7125
>T249942 WP_256876211.1 NZ_CP099911:80728-81144 [Escherichia albertii]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|