Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3542564..3543182 | Replicon | chromosome |
| Accession | NZ_CP099910 | ||
| Organism | Escherichia albertii strain 110_1_TBG_A | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NIY87_RS17375 | Protein ID | WP_001280991.1 |
| Coordinates | 3542964..3543182 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | B1EKM5 |
| Locus tag | NIY87_RS17370 | Protein ID | WP_000344798.1 |
| Coordinates | 3542564..3542938 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY87_RS17360 (3537644) | 3537644..3538837 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NIY87_RS17365 (3538860) | 3538860..3542009 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
| NIY87_RS17370 (3542564) | 3542564..3542938 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
| NIY87_RS17375 (3542964) | 3542964..3543182 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NIY87_RS17380 (3543359) | 3543359..3543916 | + | 558 | WP_000093561.1 | maltose O-acetyltransferase | - |
| NIY87_RS17385 (3544024) | 3544024..3544494 | + | 471 | WP_059224581.1 | YlaC family protein | - |
| NIY87_RS17390 (3544658) | 3544658..3546208 | + | 1551 | WP_256876043.1 | EAL domain-containing protein | - |
| NIY87_RS17395 (3546246) | 3546246..3546599 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
| NIY87_RS17405 (3546980) | 3546980..3547291 | + | 312 | WP_000409915.1 | MGMT family protein | - |
| NIY87_RS17410 (3547321) | 3547321..3547893 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249930 WP_001280991.1 NZ_CP099910:3542964-3543182 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT249930 WP_000344798.1 NZ_CP099910:3542564-3542938 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|