Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 2493857..2494461 | Replicon | chromosome |
| Accession | NZ_CP099910 | ||
| Organism | Escherichia albertii strain 110_1_TBG_A | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | NIY87_RS12385 | Protein ID | WP_059225486.1 |
| Coordinates | 2494075..2494461 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | B1ELZ9 |
| Locus tag | NIY87_RS12380 | Protein ID | WP_001195490.1 |
| Coordinates | 2493857..2494078 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY87_RS12365 (2490107) | 2490107..2491558 | + | 1452 | WP_000854601.1 | tagaturonate reductase | - |
| NIY87_RS12370 (2491763) | 2491763..2492677 | + | 915 | WP_024164792.1 | bestrophin family protein | - |
| NIY87_RS12375 (2492681) | 2492681..2493439 | - | 759 | WP_233991857.1 | trans-aconitate 2-methyltransferase | - |
| NIY87_RS12380 (2493857) | 2493857..2494078 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NIY87_RS12385 (2494075) | 2494075..2494461 | + | 387 | WP_059225486.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14452.45 Da Isoelectric Point: 7.3228
>T249926 WP_059225486.1 NZ_CP099910:2494075-2494461 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRICDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRICDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|