Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2425556..2426082 | Replicon | chromosome |
| Accession | NZ_CP099910 | ||
| Organism | Escherichia albertii strain 110_1_TBG_A | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | NIY87_RS11990 | Protein ID | WP_000323025.1 |
| Coordinates | 2425795..2426082 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | NIY87_RS11985 | Protein ID | WP_000534858.1 |
| Coordinates | 2425556..2425795 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY87_RS11945 (2420742) | 2420742..2420969 | + | 228 | WP_000476993.1 | Cro/CI family transcriptional regulator | - |
| NIY87_RS11950 (2420953) | 2420953..2421474 | + | 522 | WP_000705349.1 | toxin YdaT family protein | - |
| NIY87_RS11955 (2421455) | 2421455..2422420 | + | 966 | WP_000054504.1 | hypothetical protein | - |
| NIY87_RS11960 (2422461) | 2422461..2422880 | + | 420 | WP_001151196.1 | DUF977 family protein | - |
| NIY87_RS11965 (2422935) | 2422935..2423984 | + | 1050 | Protein_2337 | ISNCY family transposase | - |
| NIY87_RS11970 (2424105) | 2424105..2424254 | + | 150 | WP_180302674.1 | protein YdfW | - |
| NIY87_RS11975 (2424691) | 2424691..2425023 | - | 333 | WP_001317460.1 | FlxA-like family protein | - |
| NIY87_RS11980 (2425226) | 2425226..2425531 | - | 306 | WP_071527819.1 | protein YdfV | - |
| NIY87_RS11985 (2425556) | 2425556..2425795 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| NIY87_RS11990 (2425795) | 2425795..2426082 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| NIY87_RS11995 (2426154) | 2426154..2426309 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| NIY87_RS12000 (2426526) | 2426526..2426777 | + | 252 | WP_000980994.1 | protein Rem | - |
| NIY87_RS12005 (2426844) | 2426844..2427122 | + | 279 | WP_012304870.1 | hypothetical protein | - |
| NIY87_RS12010 (2427124) | 2427124..2428173 | + | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| NIY87_RS12015 (2428187) | 2428187..2428939 | + | 753 | WP_001047135.1 | antitermination protein | - |
| NIY87_RS12020 (2429217) | 2429217..2429306 | - | 90 | WP_120795389.1 | hypothetical protein | - |
| NIY87_RS12025 (2429361) | 2429361..2429573 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| NIY87_RS12030 (2429874) | 2429874..2430089 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| NIY87_RS12035 (2430453) | 2430453..2430623 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2402467..2464113 | 61646 | |
| - | inside | Prophage | - | - | 2397340..2464113 | 66773 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T249925 WP_000323025.1 NZ_CP099910:2425795-2426082 [Escherichia albertii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|