Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1962308..1962898 | Replicon | chromosome |
Accession | NZ_CP099910 | ||
Organism | Escherichia albertii strain 110_1_TBG_A |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NIY87_RS09490 | Protein ID | WP_059225520.1 |
Coordinates | 1962566..1962898 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | NIY87_RS09485 | Protein ID | WP_059225519.1 |
Coordinates | 1962308..1962565 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY87_RS09475 (1961288) | 1961288..1961758 | + | 471 | WP_059225518.1 | hypothetical protein | - |
NIY87_RS09480 (1961755) | 1961755..1961960 | + | 206 | Protein_1852 | helix-turn-helix domain-containing protein | - |
NIY87_RS09485 (1962308) | 1962308..1962565 | + | 258 | WP_059225519.1 | hypothetical protein | Antitoxin |
NIY87_RS09490 (1962566) | 1962566..1962898 | + | 333 | WP_059225520.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NIY87_RS09495 (1963011) | 1963011..1963388 | + | 378 | WP_161537949.1 | hypothetical protein | - |
NIY87_RS09500 (1963706) | 1963706..1964590 | + | 885 | WP_059225521.1 | integrase domain-containing protein | - |
NIY87_RS09505 (1964686) | 1964686..1964973 | - | 288 | WP_059225522.1 | hypothetical protein | - |
NIY87_RS09510 (1965932) | 1965932..1967194 | - | 1263 | WP_059225524.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11777.59 Da Isoelectric Point: 8.0291
>T249920 WP_059225520.1 NZ_CP099910:1962566-1962898 [Escherichia albertii]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|