Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 298155..298955 | Replicon | chromosome |
| Accession | NZ_CP099910 | ||
| Organism | Escherichia albertii strain 110_1_TBG_A | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | NIY87_RS01380 | Protein ID | WP_059225129.1 |
| Coordinates | 298428..298955 (+) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | B1EHP0 |
| Locus tag | NIY87_RS01375 | Protein ID | WP_001277106.1 |
| Coordinates | 298155..298421 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY87_RS01355 (293812) | 293812..294480 | + | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
| NIY87_RS01360 (294473) | 294473..295531 | + | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
| NIY87_RS01365 (295776) | 295776..296630 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
| NIY87_RS01370 (296902) | 296902..298005 | + | 1104 | WP_072248450.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
| NIY87_RS01375 (298155) | 298155..298421 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
| NIY87_RS01380 (298428) | 298428..298955 | + | 528 | WP_059225129.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
| NIY87_RS01385 (298952) | 298952..299335 | - | 384 | WP_000778776.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
| NIY87_RS01390 (299759) | 299759..300868 | + | 1110 | Protein_274 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NIY87_RS01395 (300916) | 300916..301842 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NIY87_RS01400 (301839) | 301839..303116 | + | 1278 | WP_256877739.1 | branched chain amino acid ABC transporter permease LivM | - |
| NIY87_RS01405 (303113) | 303113..303880 | + | 768 | WP_044709901.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19690.60 Da Isoelectric Point: 6.9585
>T249917 WP_059225129.1 NZ_CP099910:298428-298955 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLIAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLIAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|