Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 76508..77109 | Replicon | plasmid plas2 |
Accession | NZ_CP099909 | ||
Organism | Escherichia albertii strain 112_1_EW_A |
Toxin (Protein)
Gene name | doc | Uniprot ID | U9YA20 |
Locus tag | NIY89_RS24560 | Protein ID | WP_001216045.1 |
Coordinates | 76729..77109 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | NIY89_RS24555 | Protein ID | WP_001190712.1 |
Coordinates | 76508..76729 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY89_RS24545 (NIY89_24515) | 73534..74772 | - | 1239 | WP_256909406.1 | restriction endonuclease subunit S | - |
NIY89_RS24550 (NIY89_24520) | 74769..76325 | - | 1557 | WP_073511017.1 | type I restriction-modification system subunit M | - |
NIY89_RS24555 (NIY89_24525) | 76508..76729 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NIY89_RS24560 (NIY89_24530) | 76729..77109 | + | 381 | WP_001216045.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
NIY89_RS24565 (NIY89_24535) | 77114..77293 | + | 180 | WP_000113019.1 | hypothetical protein | - |
NIY89_RS24570 (NIY89_24540) | 77321..78364 | + | 1044 | WP_256876191.1 | DUF968 domain-containing protein | - |
NIY89_RS24575 (NIY89_24545) | 78453..78905 | + | 453 | WP_001326849.1 | late promoter-activating protein | - |
NIY89_RS24580 (NIY89_24550) | 78992..80185 | + | 1194 | WP_000219618.1 | hypothetical protein | - |
NIY89_RS24585 (NIY89_24555) | 80185..81669 | + | 1485 | WP_000124159.1 | hypothetical protein | - |
NIY89_RS24590 (NIY89_24560) | 81753..81983 | + | 231 | Protein_81 | ash family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..97238 | 97238 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13588.29 Da Isoelectric Point: 5.1514
>T249915 WP_001216045.1 NZ_CP099909:76729-77109 [Escherichia albertii]
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANISRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CLP7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |