Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 15532..16175 | Replicon | plasmid plas1 |
Accession | NZ_CP099908 | ||
Organism | Escherichia albertii strain 112_1_EW_A |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | NIY89_RS23725 | Protein ID | WP_256876211.1 |
Coordinates | 15532..15948 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | - |
Locus tag | NIY89_RS23730 | Protein ID | WP_256876210.1 |
Coordinates | 15945..16175 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY89_RS23700 (10583) | 10583..10924 | - | 342 | Protein_12 | protein RepA | - |
NIY89_RS23705 (11461) | 11461..12057 | - | 597 | WP_256876215.1 | hypothetical protein | - |
NIY89_RS23710 (12045) | 12045..12314 | - | 270 | WP_256876214.1 | hypothetical protein | - |
NIY89_RS23715 (12633) | 12633..14204 | + | 1572 | WP_256876213.1 | ATP-binding protein | - |
NIY89_RS23720 (14412) | 14412..15392 | - | 981 | WP_256909404.1 | hypothetical protein | - |
NIY89_RS23725 (15532) | 15532..15948 | - | 417 | WP_256876211.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NIY89_RS23730 (15945) | 15945..16175 | - | 231 | WP_256876210.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NIY89_RS23735 (16744) | 16744..17157 | + | 414 | WP_000465043.1 | hypothetical protein | - |
NIY89_RS23740 (17159) | 17159..17941 | + | 783 | WP_021533580.1 | site-specific integrase | - |
NIY89_RS23745 (18114) | 18114..18467 | + | 354 | WP_000864812.1 | colicin M immunity protein | - |
NIY89_RS23750 (18517) | 18517..19332 | - | 816 | WP_000449473.1 | lipid II-degrading bacteriocin colicin M | - |
NIY89_RS23755 (19575) | 19575..20102 | + | 528 | WP_000203268.1 | colicin B immunity protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | espL2 / espL2 | 1..89078 | 89078 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15080.41 Da Isoelectric Point: 6.7125
>T249912 WP_256876211.1 NZ_CP099908:c15948-15532 [Escherichia albertii]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAISGHAIAAGAILVTNNTREFERVPGLILEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|