Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3545136..3545754 | Replicon | chromosome |
Accession | NZ_CP099907 | ||
Organism | Escherichia albertii strain 112_1_EW_A |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NIY89_RS17405 | Protein ID | WP_001280991.1 |
Coordinates | 3545536..3545754 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | B1EKM5 |
Locus tag | NIY89_RS17400 | Protein ID | WP_000344798.1 |
Coordinates | 3545136..3545510 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY89_RS17390 (3540216) | 3540216..3541409 | + | 1194 | WP_010334435.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NIY89_RS17395 (3541432) | 3541432..3544581 | + | 3150 | WP_001132500.1 | efflux RND transporter permease AcrB | - |
NIY89_RS17400 (3545136) | 3545136..3545510 | + | 375 | WP_000344798.1 | Hha toxicity modulator TomB | Antitoxin |
NIY89_RS17405 (3545536) | 3545536..3545754 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NIY89_RS17410 (3545931) | 3545931..3546488 | + | 558 | WP_000093561.1 | maltose O-acetyltransferase | - |
NIY89_RS17415 (3546596) | 3546596..3547066 | + | 471 | WP_059224581.1 | YlaC family protein | - |
NIY89_RS17420 (3547230) | 3547230..3548780 | + | 1551 | WP_256876043.1 | EAL domain-containing protein | - |
NIY89_RS17425 (3548818) | 3548818..3549171 | - | 354 | WP_000878151.1 | DUF1428 family protein | - |
NIY89_RS17435 (3549552) | 3549552..3549863 | + | 312 | WP_000409915.1 | MGMT family protein | - |
NIY89_RS17440 (3549893) | 3549893..3550465 | - | 573 | WP_000779847.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T249903 WP_001280991.1 NZ_CP099907:3545536-3545754 [Escherichia albertii]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14499.35 Da Isoelectric Point: 4.8989
>AT249903 WP_000344798.1 NZ_CP099907:3545136-3545510 [Escherichia albertii]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKANPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|