Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 2496431..2497035 | Replicon | chromosome |
Accession | NZ_CP099907 | ||
Organism | Escherichia albertii strain 112_1_EW_A |
Toxin (Protein)
Gene name | doc | Uniprot ID | - |
Locus tag | NIY89_RS12415 | Protein ID | WP_059225486.1 |
Coordinates | 2496649..2497035 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | B1ELZ9 |
Locus tag | NIY89_RS12410 | Protein ID | WP_001195490.1 |
Coordinates | 2496431..2496652 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY89_RS12395 (2492681) | 2492681..2494132 | + | 1452 | WP_000854601.1 | tagaturonate reductase | - |
NIY89_RS12400 (2494337) | 2494337..2495251 | + | 915 | WP_024164792.1 | bestrophin family protein | - |
NIY89_RS12405 (2495255) | 2495255..2496013 | - | 759 | WP_233991857.1 | trans-aconitate 2-methyltransferase | - |
NIY89_RS12410 (2496431) | 2496431..2496652 | + | 222 | WP_001195490.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NIY89_RS12415 (2496649) | 2496649..2497035 | + | 387 | WP_059225486.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14452.45 Da Isoelectric Point: 7.3228
>T249899 WP_059225486.1 NZ_CP099907:2496649-2497035 [Escherichia albertii]
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRICDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
MIWVSAQEVIAFHDRILQRFPGVAGLTDPGRAQALIYRVQNRVHYEGVTDLFELAATYWVAIARGHIFHDGNKRTAFFVT
MTFLWRNGIRICDVDNSLENLTVEAATGEKTVGQLARCLRERVDSSGN
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|