Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2428130..2428656 | Replicon | chromosome |
| Accession | NZ_CP099907 | ||
| Organism | Escherichia albertii strain 112_1_EW_A | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | NIY89_RS12020 | Protein ID | WP_000323025.1 |
| Coordinates | 2428369..2428656 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | NIY89_RS12015 | Protein ID | WP_000534858.1 |
| Coordinates | 2428130..2428369 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY89_RS11975 (2423316) | 2423316..2423543 | + | 228 | WP_000476993.1 | Cro/CI family transcriptional regulator | - |
| NIY89_RS11980 (2423527) | 2423527..2424048 | + | 522 | WP_000705349.1 | toxin YdaT family protein | - |
| NIY89_RS11985 (2424029) | 2424029..2424994 | + | 966 | WP_000054504.1 | hypothetical protein | - |
| NIY89_RS11990 (2425035) | 2425035..2425454 | + | 420 | WP_001151196.1 | DUF977 family protein | - |
| NIY89_RS11995 (2425509) | 2425509..2426558 | + | 1050 | Protein_2344 | ISNCY family transposase | - |
| NIY89_RS12000 (2426679) | 2426679..2426828 | + | 150 | WP_180302674.1 | protein YdfW | - |
| NIY89_RS12005 (2427265) | 2427265..2427597 | - | 333 | WP_001317460.1 | FlxA-like family protein | - |
| NIY89_RS12010 (2427800) | 2427800..2428105 | - | 306 | WP_071527819.1 | protein YdfV | - |
| NIY89_RS12015 (2428130) | 2428130..2428369 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| NIY89_RS12020 (2428369) | 2428369..2428656 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| NIY89_RS12025 (2428728) | 2428728..2428883 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| NIY89_RS12030 (2429100) | 2429100..2429351 | + | 252 | WP_000980994.1 | protein Rem | - |
| NIY89_RS12035 (2429418) | 2429418..2429696 | + | 279 | WP_012304870.1 | hypothetical protein | - |
| NIY89_RS12040 (2429698) | 2429698..2430747 | + | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
| NIY89_RS12045 (2430761) | 2430761..2431513 | + | 753 | WP_001047135.1 | antitermination protein | - |
| NIY89_RS12050 (2431791) | 2431791..2431880 | - | 90 | WP_120795389.1 | hypothetical protein | - |
| NIY89_RS12055 (2431935) | 2431935..2432147 | - | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
| NIY89_RS12060 (2432448) | 2432448..2432663 | + | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
| NIY89_RS12065 (2433027) | 2433027..2433197 | - | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2416709..2466687 | 49978 | |
| - | inside | Prophage | - | - | 2412810..2466687 | 53877 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T249898 WP_000323025.1 NZ_CP099907:2428369-2428656 [Escherichia albertii]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|