Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
Location | 1963541..1964131 | Replicon | chromosome |
Accession | NZ_CP099907 | ||
Organism | Escherichia albertii strain 112_1_EW_A |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | NIY89_RS09510 | Protein ID | WP_059225520.1 |
Coordinates | 1963799..1964131 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | NIY89_RS09505 | Protein ID | WP_059225519.1 |
Coordinates | 1963541..1963798 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY89_RS09495 (1962521) | 1962521..1962991 | + | 471 | WP_059225518.1 | hypothetical protein | - |
NIY89_RS09500 (1962988) | 1962988..1963193 | + | 206 | Protein_1857 | helix-turn-helix domain-containing protein | - |
NIY89_RS09505 (1963541) | 1963541..1963798 | + | 258 | WP_059225519.1 | hypothetical protein | Antitoxin |
NIY89_RS09510 (1963799) | 1963799..1964131 | + | 333 | WP_059225520.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NIY89_RS09515 (1964244) | 1964244..1964621 | + | 378 | WP_161537949.1 | hypothetical protein | - |
NIY89_RS09520 (1964939) | 1964939..1965823 | + | 885 | WP_059225521.1 | integrase domain-containing protein | - |
NIY89_RS09525 (1965919) | 1965919..1966206 | - | 288 | WP_059225522.1 | hypothetical protein | - |
NIY89_RS09530 (1967165) | 1967165..1968427 | - | 1263 | WP_059225524.1 | integrase arm-type DNA-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11777.59 Da Isoelectric Point: 8.0291
>T249893 WP_059225520.1 NZ_CP099907:1963799-1964131 [Escherichia albertii]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSPASFNEVTRLPVIVPVTSGGQFARSAGFAVSLEGAGTKTTGIIRCDQPRTI
DMGARNGKRLERIPDGIINEVLARLETILA
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|