Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
Location | 298162..298962 | Replicon | chromosome |
Accession | NZ_CP099907 | ||
Organism | Escherichia albertii strain 112_1_EW_A |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | NIY89_RS01385 | Protein ID | WP_059225129.1 |
Coordinates | 298435..298962 (+) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | B1EHP0 |
Locus tag | NIY89_RS01380 | Protein ID | WP_001277106.1 |
Coordinates | 298162..298428 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NIY89_RS01360 (293819) | 293819..294487 | + | 669 | WP_000617720.1 | cell division ATP-binding protein FtsE | - |
NIY89_RS01365 (294480) | 294480..295538 | + | 1059 | WP_001042000.1 | permease-like cell division protein FtsX | - |
NIY89_RS01370 (295783) | 295783..296637 | + | 855 | WP_000130217.1 | RNA polymerase sigma factor RpoH | - |
NIY89_RS01375 (296909) | 296909..298012 | + | 1104 | WP_072248450.1 | branched chain amino acid ABC transporter substrate-binding protein LivJ | - |
NIY89_RS01380 (298162) | 298162..298428 | + | 267 | WP_001277106.1 | type II toxin-antitoxin system antitoxin AtaR | Antitoxin |
NIY89_RS01385 (298435) | 298435..298962 | + | 528 | WP_059225129.1 | type II toxin-antitoxin system toxin acetyltransferase AtaT | Toxin |
NIY89_RS01390 (298959) | 298959..299342 | - | 384 | WP_000778776.1 | aspartate 1-decarboxylase autocleavage activator PanM | - |
NIY89_RS01395 (299766) | 299766..300875 | + | 1110 | Protein_275 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
NIY89_RS01400 (300923) | 300923..301849 | + | 927 | WP_001295097.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
NIY89_RS01405 (301846) | 301846..303123 | + | 1278 | WP_256877739.1 | branched chain amino acid ABC transporter permease LivM | - |
NIY89_RS01410 (303120) | 303120..303887 | + | 768 | WP_044709901.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19690.60 Da Isoelectric Point: 6.9585
>T249890 WP_059225129.1 NZ_CP099907:298435-298962 [Escherichia albertii]
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLIAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
MDDLTIEILTDDADYDLQRFDCGEEALNLFLTTHLVRQHRNKILRAYILCRNTPERQVLGYYTLSGSCFERAALPSKSKQ
KKIPYKNIPSVTLGRLAIDRSLQGQGWGATLIAHAMKVVWSASLAVGIHGLFVEALNEKAHTFYQSLGFIPLVGENENAL
FFPTKSIELLFTQSD
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|